BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C04 (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58730-3|AAT92069.1| 523|Caenorhabditis elegans Suppressor of l... 29 4.6 Z35598-1|CAA84656.1| 1343|Caenorhabditis elegans Hypothetical pr... 28 6.0 >U58730-3|AAT92069.1| 523|Caenorhabditis elegans Suppressor of lineage defect protein1, isoform c protein. Length = 523 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -1 Query: 371 VVISDFRPVPTVIIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSKITIAHIE 207 V+I F+P P +EI+ KNV AEK ++ + + + S + I +E Sbjct: 423 VIIDRFKPTP---VEIEKAKNVAAAEKKLISLVPDVPPRTSSQTSSSYVNIKELE 474 >Z35598-1|CAA84656.1| 1343|Caenorhabditis elegans Hypothetical protein F10F2.2 protein. Length = 1343 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIK-SLSINIEWEGRRSKITIAHIEPDI 198 I E GIKNVE E+ + Y ++ + +N +E K+T A D+ Sbjct: 104 IFESSGIKNVERIERGIRYLVEDDVDVNEFFEIAADKMTEAIYGNDV 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,972,675 Number of Sequences: 27780 Number of extensions: 252840 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -