BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C04 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 1.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 5.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 9.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 9.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.2 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 152 HGWLSVLLYATLKSSKYQAQYELS*FSTDGPPIQY 256 + WLSV + + ++ + QY L F+T P + Y Sbjct: 162 NNWLSVFWGSAWQWNEERKQYYLHQFATGQPDLNY 196 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.2 bits (45), Expect = 5.3 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +1 Query: 283 KTLFSACXXXXXXXXXXXXVGTGRKSEITTTQHACNITFKN*VN 414 + L AC V TG SEIT Q A + +K+ N Sbjct: 197 ENLVQACFQQAQTTYVTKEVATGTASEITQIQEA-TLVYKDGTN 239 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSK 228 I E + IKNV + + L +NIE G SK Sbjct: 173 IFEREEIKNVLTKINKIKEHDTVLVVNIEKSGNESK 208 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSK 228 I E + IKNV + + L +NIE G SK Sbjct: 173 IFEREEIKNVLTKINKIKEHDTVLVVNIEKSGNESK 208 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSK 228 I E + IKNV + + L +NIE G SK Sbjct: 173 IFEREEIKNVLTKINKIKEHDTVLVVNIEKSGNESK 208 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSK 228 I E + IKNV + + L +NIE G SK Sbjct: 178 IFEREEIKNVLTKINKIKEHDTVLVVNIEKSGNESK 213 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSK 228 I E + IKNV + + L +NIE G SK Sbjct: 173 IFEREEIKNVLTKINKIKEHDTVLVVNIEKSGNESK 208 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 335 IIEIDGIKNVEHAEKSVLYYIKSLSINIEWEGRRSK 228 I E + IKNV + + L +NIE G SK Sbjct: 173 IFEREEIKNVLTKINKIKEHDTVLVVNIEKSGNESK 208 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,263 Number of Sequences: 438 Number of extensions: 2873 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -