BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_C03 (339 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92781-5|CAB07179.2| 1391|Caenorhabditis elegans Hypothetical pr... 26 6.0 AF067607-2|AAF98611.1| 109|Caenorhabditis elegans Hypothetical ... 26 6.0 >Z92781-5|CAB07179.2| 1391|Caenorhabditis elegans Hypothetical protein F09C3.1 protein. Length = 1391 Score = 26.2 bits (55), Expect = 6.0 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -1 Query: 297 NVLQL*NLVSHK-KTALKSFDRRTKILFAIKKNRQQSLLERTAEDFYYL 154 N L L +++H+ KTA + D K + KK R++ +E + YYL Sbjct: 726 NRLNLQEVIAHRDKTAASAEDYAAKNEVSEKKQREKCSVESLEQLLYYL 774 >AF067607-2|AAF98611.1| 109|Caenorhabditis elegans Hypothetical protein C18H7.5 protein. Length = 109 Score = 26.2 bits (55), Expect = 6.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 211 NCKQNLCTPIK*FQCCFFVAHQIL*LQNIS 300 NC+ N + F+ CF +A QIL + +S Sbjct: 43 NCENNCLQNLAGFKFCFQIAQQILVIYRVS 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,052,447 Number of Sequences: 27780 Number of extensions: 128197 Number of successful extensions: 295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 429601520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -