BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B23 (438 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 28 0.55 SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual 26 2.9 SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ... 25 5.1 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 25 6.7 SPAC9.06c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual 24 8.9 SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces p... 24 8.9 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 28.3 bits (60), Expect = 0.55 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 268 ILQHRRPRLPLMQLEAPCSFNFCSLRA 348 I Q LP + L +PCSF CSLRA Sbjct: 48 IAQKSNISLPFLTL-SPCSFTICSLRA 73 >SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 2.9 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 266 WHW-GSVDSISGSHARFQLSGNSGRKHSRCCTSILRK 159 W W GSVD SG N R S TS+LR+ Sbjct: 39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQ 75 >SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.0 bits (52), Expect = 5.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 241 MESTDPQCHILQHRRPRLPLMQLEAPCSF 327 M+S Q ++L RP LPL P F Sbjct: 88 MDSLSHQIYLLHKNRPTLPLKPTNQPTRF 116 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 24.6 bits (51), Expect = 6.7 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 335 QKLKEHGASSCISGKRGRRCCNIWHWGS 252 Q E A +C G G C +W+W + Sbjct: 394 QSSAEAAALACSGGSDGVTCGYMWYWNN 421 >SPAC9.06c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual Length = 192 Score = 24.2 bits (50), Expect = 8.9 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = +1 Query: 88 HHLMAWGLPWQQQSTVTQC 144 H ++ WG W++ T +C Sbjct: 160 HGVIGWGATWEKSKTQMEC 178 >SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 24.2 bits (50), Expect = 8.9 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 Query: 287 GRRCCNIWHWGSVDSISGSHARFQLSGNSGRKHSR 183 G R C W S+D +S S+A Q G +R Sbjct: 287 GGRYCETVGWLSIDGLSASNATRQYVGRPVTNETR 321 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,620,099 Number of Sequences: 5004 Number of extensions: 28811 Number of successful extensions: 60 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 158122380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -