BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B23 (438 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15840.1 68417.m02409 expressed protein 30 0.79 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 4.2 At5g07790.1 68418.m00892 expressed protein 27 5.5 At4g03610.1 68417.m00496 phosphonate metabolism protein-related ... 27 5.5 At3g29680.1 68416.m03741 transferase family protein similar to a... 26 9.7 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.9 bits (64), Expect = 0.79 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 242 ISGSHARFQLSGNSGRKHSRCCTSILRKFSG 150 +SGS+ FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 332 KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 234 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 27.1 bits (57), Expect = 5.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 311 SSCISGKRGRRCCNIWHWGSVDSISGSHARFQLSGNSGRKHSRCCTSI 168 S + KR RR + G+ +S + A +S SGR+ + C TS+ Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457 >At4g03610.1 68417.m00496 phosphonate metabolism protein-related weak similarity to PhnP protein. (Swiss-Prot:P16692) [Escherichia coli] Length = 290 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +1 Query: 238 LMESTDPQCHILQHRRPRLPLMQLEAPCS----FNFCSLRAIRRYKSYYVD*G 384 L++ +DP CH+ LP + C+ ++CS R+K +D G Sbjct: 30 LLQPSDPPCHVCSQSLSLLPHLNPNYRCNTSLLIDYCSKEEDGRHKYILIDVG 82 >At3g29680.1 68416.m03741 transferase family protein similar to anthocyanin 5-aromatic acyltransferase from Gentiana triflora GI:4185599, malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase from Perilla frutescens GI:17980232, Salvia splendens GI:17980234; contains Pfam profile PF02458 transferase family Length = 451 Score = 26.2 bits (55), Expect = 9.7 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +1 Query: 133 VTQCCRPLNFRSML--VQQRLCFL--PLFPLS*NRAWEPLMESTDPQCHILQHRRPRLPL 300 +T+ R F S+L ++Q L + PLS + W P DP+ HI+ + + L Sbjct: 46 LTESSRDSFFSSILPKLEQSLSLVLSHFLPLSGHLKWNP----QDPKPHIVIFPKDTVSL 101 Query: 301 MQLEAPCSFNFCSLRAIR 354 +E+ F++ S + +R Sbjct: 102 TVVESEADFSYISSKELR 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,675,955 Number of Sequences: 28952 Number of extensions: 160842 Number of successful extensions: 354 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 692941200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -