BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B22 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 5.2 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 5.2 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 210 AGQVLRC*QPNLLTNMRPTVAGATSSSITISRSHLHLVRGG 332 +G RC +P++ + PT A +SSS + S + + GG Sbjct: 773 SGSGSRCSKPSVTSTTPPTPASLSSSSSSSSSASSTSLCGG 813 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 575 NCLPPLYQYAHPLP*IQSPLHQ*KHSNNINPT 670 +C PP+ LP +Q H S+ ++PT Sbjct: 439 SCHPPIDHVCELLPRLQPRYHSISSSSKLHPT 470 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,398 Number of Sequences: 2352 Number of extensions: 15319 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -