BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B22 (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18640.1 68416.m02368 zinc finger protein-related contains si... 30 1.3 At5g48390.1 68418.m05983 tetratricopeptide repeat (TPR)-containi... 27 8.8 >At3g18640.1 68416.m02368 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 676 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -3 Query: 451 NNPRHQNIVRRIYCQLGKCISIGTIPNIQHCIKNHLFCSHPPLTK 317 N ++NIV+++ ++ + G +P Q I ++L S P LTK Sbjct: 620 NKDGYKNIVKKVAEKVTGTMQSGNVPQTQEKIDHYLSASKPKLTK 664 >At5g48390.1 68418.m05983 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 900 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 144 SWYCVICCNLSTLCFSLKSGEIAGQVLR 227 +W+ C NL + C K E+ G+ LR Sbjct: 612 NWFAATCWNLGSRCGKEKKYELCGEFLR 639 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,813,640 Number of Sequences: 28952 Number of extensions: 301355 Number of successful extensions: 687 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -