BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B20 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 3.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.8 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 8.9 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 8.9 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 8.9 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 8.9 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 8.9 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.2 bits (50), Expect = 3.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 181 PSKQKYIGIVSVQSFLFPTMNYFKN 107 P + Y+GIV V +L NYF++ Sbjct: 108 PKFRLYVGIVYVPPYLSSDRNYFES 132 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 108 FLK*FIVGNKKLCTETIPMYFCFEGCGYHVC 200 F K +VG K C + P Y+ F G H C Sbjct: 959 FCKPGVVGKK--CDKCAPAYYGFSEDGCHAC 987 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 8.9 Identities = 6/22 (27%), Positives = 15/22 (68%) Frame = -3 Query: 173 TKIHWNSFCTKFFIPYDELLQE 108 T++H + FC +F + ++L++ Sbjct: 468 TEVHRSCFCVRFIAEHTKMLED 489 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 8.9 Identities = 6/22 (27%), Positives = 15/22 (68%) Frame = -3 Query: 173 TKIHWNSFCTKFFIPYDELLQE 108 T++H + FC +F + ++L++ Sbjct: 468 TEVHRSCFCVRFIAEHTKMLED 489 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 230 MQRMHMHVISTDMISTSLKTKIHWNS 153 ++RMHM V S LK ++ W + Sbjct: 814 LKRMHMDVASLTQQMPRLKEQVDWQA 839 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 335 NKSHISLLEEFGNIFKELKEENESELRAGFHAI 237 NK+H E+ G +F NE+E FH++ Sbjct: 558 NKNHDLFWEDIGQVFDGFHAINENEFDI-FHSL 589 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.0 bits (47), Expect = 8.9 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -3 Query: 377 LVLPHEEINSIYKLNKSHISLLEEFGNIFKELKEENESELRAGFHAIP 234 LVL E+ + YKL + L + +++L+ E + R + +P Sbjct: 431 LVLLSEKFEAEYKLTTNLEILTDRLQQTYRDLESEKQKTDRLLYSVLP 478 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,676 Number of Sequences: 2352 Number of extensions: 10867 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -