BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B20 (679 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01310.1 68418.m00043 basic helix-loop-helix (bHLH) family pr... 109 2e-24 At4g16566.1 68417.m02507 histidine triad family protein / HIT fa... 45 5e-05 At1g31160.1 68414.m03812 zinc-binding protein, putative / protei... 40 0.002 At5g11940.1 68418.m01396 subtilase family protein contains simil... 29 2.1 At5g37550.1 68418.m04522 expressed protein 29 2.8 At3g57350.1 68416.m06384 nucleoporin interacting component-relat... 29 2.8 At2g41620.1 68415.m05143 nucleoporin interacting component famil... 29 3.7 At3g49170.1 68416.m05374 pentatricopeptide (PPR) repeat-containi... 28 4.9 At1g14840.1 68414.m01775 expressed protein 28 6.5 At5g12260.1 68418.m01441 expressed protein 27 8.6 At2g36680.2 68415.m04500 expressed protein 27 8.6 At2g36680.1 68415.m04499 expressed protein 27 8.6 >At5g01310.1 68418.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain, weak hit to PF01661: Appr-1-p processing enzyme family Length = 912 Score = 109 bits (262), Expect = 2e-24 Identities = 62/170 (36%), Positives = 99/170 (58%), Gaps = 10/170 (5%) Frame = -3 Query: 503 SKTPKHWSLGLIASMKDP----NSIIKNTEKVVVIKDKYPKAKVHYLVLPHEE-INSIYK 339 SK W+L L + P N +++ + +VVI D+YPKA+ H LVL +E ++ + Sbjct: 710 SKGWNTWALALHSIAMHPERHENVVLEYLDNIVVINDQYPKARKHVLVLARQESLDGLED 769 Query: 338 LNKSHISLLEEFGNIFKELKEENESE-----LRAGFHAIPSMQRMHMHVISTDMISTSLK 174 + K ++ LL+E N+ + + ++E R G+H++PSM+++H+HVIS D S SLK Sbjct: 770 VRKENLQLLQEMHNVGLKWVDRFQNEDASLIFRLGYHSVPSMRQLHLHVISQDFNSDSLK 829 Query: 173 TKIHWNSFCTKFFIPYDELLQELKDIGNIRKIPSELHTSLMKTPLQCNQC 24 K HWNSF T FF ++L+E+ G + SE L+K L+CN+C Sbjct: 830 NKKHWNSFTTSFFRDSVDVLEEVNSQGK-ANVASE---DLLKGELRCNRC 875 >At4g16566.1 68417.m02507 histidine triad family protein / HIT family protein contains Pfam domain, PF01230: HIT family (histidine triad protein family) Length = 146 Score = 44.8 bits (101), Expect = 5e-05 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 6/84 (7%) Frame = -3 Query: 443 IIKNTEKVVVIKDKYPKAKVHYLVLPHEEINSIYKLNK--SHISLLEEFGNIFKEL--KE 276 ++ EKV+ +D P A+ HYLV+P E I ++ L + SL+ ++ ++L K+ Sbjct: 22 LLHTDEKVIAFQDIKPAAQRHYLVIPKEHIPTVNDLQRRDEDYSLVRHMLSVGQQLLQKD 81 Query: 275 ENESELRAGFHAIP--SMQRMHMH 210 +S R GFH P S+ +H+H Sbjct: 82 APQSIHRFGFHQPPFNSVDHLHLH 105 >At1g31160.1 68414.m03812 zinc-binding protein, putative / protein kinase C inhibitor, putative similar to 14 kDa zinc-binding protein (Protein kinase C inhibitor, PKCI) [Zea mays] Swiss-Prot:P42856 Length = 187 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 8/97 (8%) Frame = -3 Query: 470 IASMKDPNSIIKNTEKVVVIKDKYPKAKVHYLVLP--HEEINSIYKLNKSHISLLEEFGN 297 I + + P+ I+ E V+ +D P+A VH LV+P + + S+ K H+ +L + + Sbjct: 81 IIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTSLGKAEPRHVEVLGQLLH 140 Query: 296 IFKELKEEN------ESELRAGFHAIPSMQRMHMHVI 204 K + E+ + G A S+ +H+HV+ Sbjct: 141 ASKIVAEKEGILDGFRVVINNGVEACQSVYHLHLHVL 177 >At5g11940.1 68418.m01396 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 762 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/65 (29%), Positives = 27/65 (41%) Frame = -3 Query: 440 IKNTEKVVVIKDKYPKAKVHYLVLPHEEINSIYKLNKSHISLLEEFGNIFKELKEENESE 261 I E +V Y + KVH + L +E N + SH+ +LE K+ E Sbjct: 19 ILKVEFNIVEGGAYEETKVHIVYLGEKEHNDPELVTSSHLRMLESLLGSKKDASESIVHS 78 Query: 260 LRAGF 246 R GF Sbjct: 79 YRNGF 83 >At5g37550.1 68418.m04522 expressed protein Length = 230 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 551 STPIMSKRKNTTSSIPSKTPKHWSLGLIA 465 STPIMS++K+ T S + K WS L A Sbjct: 10 STPIMSEKKSITRSRNNSRKKRWSPTLFA 38 >At3g57350.1 68416.m06384 nucleoporin interacting component-related contains weak hit to Pfam profile PF04097: Nucleoporin interacting component Length = 875 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +2 Query: 23 NIDCIAVEFSLVKYAILKESSLCYQCLLVLEVIHRRE*KTLYRNYSNVFLF*G 181 NID + V SLV ++IL E S + L V++ E ++ R Y +++L G Sbjct: 532 NIDAVHVAISLVDHSILSEGSGTGRKLSVMDA--NAEASSMIRQYGSMYLHHG 582 >At2g41620.1 68415.m05143 nucleoporin interacting component family protein contains Pfam profile PF04097: Nucleoporin interacting component Length = 861 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 23 NIDCIAVEFSLVKYAILKESSLCYQCLLVLEVIHRRE*KTLYRNYSNVFLF*G 181 NID + + SLV +++L E S L V++ E ++ R Y ++FL G Sbjct: 531 NIDAVHIAISLVDHSVLSEGSGTGHKLSVMD--SNAEASSMIRQYGSMFLHHG 581 >At3g49170.1 68416.m05374 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 850 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 128 YDELLQELKDIGNIRKIPSELHTSLMKTPLQCNQ 27 + LL + ++G+IRK ++H+ ++K L CNQ Sbjct: 477 FASLLSGVANVGSIRK-GEQIHSQVVKLGLSCNQ 509 >At1g14840.1 68414.m01775 expressed protein Length = 604 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 362 EEINSIYKLNKSHISLLEEFGNIFKELKEENESELRAGFHAIPSMQRMHMHVISTDM 192 EE+ + + K +LLE K++ EE ++ + A F A S++R+H DM Sbjct: 95 EELGKMAEKLKLIENLLESKNLEIKKINEEKKASMAAQFAAEASLRRVHAAQKDDDM 151 >At5g12260.1 68418.m01441 expressed protein Length = 624 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/83 (18%), Positives = 36/83 (43%) Frame = -3 Query: 335 NKSHISLLEEFGNIFKELKEENESELRAGFHAIPSMQRMHMHVISTDMISTSLKTKIHWN 156 ++ + ++ F N ++ + G A P Q ++ +S+D + + + W Sbjct: 301 SRGYFNIYTSFPNEGALSVSHRDAGVNYGRTAGPDSQLLNKSSLSSDSLKLQPLSNLKWY 360 Query: 155 SFCTKFFIPYDELLQELKDIGNI 87 FC +P +++ L ++G I Sbjct: 361 DFCFSEVVP-GRVVRNLNELGTI 382 >At2g36680.2 68415.m04500 expressed protein Length = 168 Score = 27.5 bits (58), Expect = 8.6 Identities = 25/84 (29%), Positives = 39/84 (46%) Frame = -3 Query: 536 SKRKNTTSSIPSKTPKHWSLGLIASMKDPNSIIKNTEKVVVIKDKYPKAKVHYLVLPHEE 357 S R T+ IPS + G+IA +KD + + K++ KD Y + +H L + Sbjct: 37 SSRPQTSGQIPSHVSPGEAAGIIAILKDKS--VDELRKLLSDKDAYQQF-LHSLDQVTIQ 93 Query: 356 INSIYKLNKSHISLLEEFGNIFKE 285 N +L K + L E N+ KE Sbjct: 94 NNIREELRKETLHLARE--NLEKE 115 >At2g36680.1 68415.m04499 expressed protein Length = 218 Score = 27.5 bits (58), Expect = 8.6 Identities = 25/84 (29%), Positives = 39/84 (46%) Frame = -3 Query: 536 SKRKNTTSSIPSKTPKHWSLGLIASMKDPNSIIKNTEKVVVIKDKYPKAKVHYLVLPHEE 357 S R T+ IPS + G+IA +KD + + K++ KD Y + +H L + Sbjct: 37 SSRPQTSGQIPSHVSPGEAAGIIAILKDKS--VDELRKLLSDKDAYQQF-LHSLDQVTIQ 93 Query: 356 INSIYKLNKSHISLLEEFGNIFKE 285 N +L K + L E N+ KE Sbjct: 94 NNIREELRKETLHLARE--NLEKE 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,954,560 Number of Sequences: 28952 Number of extensions: 213969 Number of successful extensions: 639 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -