BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B17 (577 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 1.4 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 7.5 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.5 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 7.5 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.4 bits (48), Expect = 1.4 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = -1 Query: 463 PQQNPQDVQILRFDSNVEPDGYSFAYETSDGTSRQEEGKLDNP 335 PQ DV + DS+V P G F YE + DNP Sbjct: 651 PQNPDNDVHSIVDDSDVGPSGDCF-YENKFYRQEAQWTSSDNP 692 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = +2 Query: 284 SYVSILSSNCQSCILGLWVVEFAFFLSGCT 373 +YV+ +N + I+ W+ F ++ C+ Sbjct: 293 AYVTRTGANIKKLIVNTWISLFCVKVTNCS 322 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.0 bits (42), Expect = 7.5 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = -1 Query: 514 LKYVTVACVLVALCSGAPQQNPQDVQILRFDSNVEPDGYSFAY 386 LKY + + V G NP+DV+++ D+ + + + Sbjct: 64 LKYYPIYKLDVCGTGGVNLLNPEDVELVLTDTKQNTKSFIYHF 106 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +1 Query: 289 RKHTVQ*LSELHSRTVGCRVC 351 R+H++ L E + + CR+C Sbjct: 235 RRHSINLLEEDNQKPNVCRIC 255 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,660 Number of Sequences: 336 Number of extensions: 2852 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -