BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B17 (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 29.5 bits (63), Expect = 2.1 Identities = 24/95 (25%), Positives = 37/95 (38%), Gaps = 3/95 (3%) Frame = -1 Query: 463 PQQNPQDVQILRFDSNVEPDGYSFA---YETSDGTSRQEEGKLDNPQSENAALTVTGQYA 293 P NP+D Q + +P G S T+ GT+ Q G NP+ + L Q + Sbjct: 394 PSHNPRD-QATTLGTKPQPWGPSHNPRDQATTLGTTPQPSGPSQNPRDQAKTLGTKPQPS 452 Query: 292 YVAPDGKHYTVTFTAGPNGFQPXTSLGQKXKPQKP 188 + + + T P P + G + KP P Sbjct: 453 GPSQNPRDQAKTLGTKPQPSGPSQNPGDQQKPSGP 487 >SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -1 Query: 403 GYSFAYETSDGTSRQEEGKLDNPQSENAALTVTGQYAYVAPDGKHY 266 G+S + + S + ++G NPQ EN + G Y+ + D +Y Sbjct: 276 GWSGSNQRSGNVASNQQGGDTNPQQENYGNSNYGNYSNFSSDNGNY 321 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,138,639 Number of Sequences: 59808 Number of extensions: 368172 Number of successful extensions: 876 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -