BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B16 (583 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) 32 0.30 SB_1534| Best HMM Match : zf-FPG_IleRS (HMM E-Value=6.2) 29 3.7 >SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1805 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -3 Query: 542 WEAERPVKPILRKLFEGKKLVCCETAWNDFEKILETLG 429 WEA R R+ E ++LV C WN+F K +E LG Sbjct: 1477 WEAVRKNAESRRRQAE-ERLVLCREYWNEFRKFVEWLG 1513 >SB_1534| Best HMM Match : zf-FPG_IleRS (HMM E-Value=6.2) Length = 76 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = -3 Query: 542 WEAERPVKPILRKLFEGKKLVCCETAWNDFEKILETLGGPMEKKR 408 W RP + ++R+ E + C T W+ T GP E+ R Sbjct: 28 WPTWRPSRSVVRRSSE-LSMARCRTVWSHIGDETTTFAGPRERHR 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,060,559 Number of Sequences: 59808 Number of extensions: 272802 Number of successful extensions: 612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -