BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B15 (632 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 3.7 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 6.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 6.5 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 21 8.6 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.2 bits (45), Expect = 3.7 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -2 Query: 322 NQKLLQHHC---YVNCPLKL*VTAYHIIFYHILSLKSLYQHCVFIVEIYIYLCY 170 N+ L+H+ +VN + + + F I+ LKS+ + + +EIY Y Sbjct: 89 NEPKLRHYLIFIFVNVFFWVIILMSNYAFTRIILLKSVLEIVIIDIEIYSQFLY 142 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +3 Query: 411 RKHSQESRLIWHAHLQTSLPHPHPSHGLLQIFR 509 + H+ +IW + L P +GLL++ + Sbjct: 342 KDHNMAGLMIWTVDMDDFLGLCGPKNGLLEVIK 374 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 6.5 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 369 LIFDVELLRLE*IQFVTKNYYNIIVMSIAL*NSKSQLITL 250 L VE R E I F+T+ Y+ + +AL ITL Sbjct: 42 LALGVERTRSELIPFLTETIYDEDEVLLALAEQLGSFITL 81 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 141 KFMVRLINEILKIIDSI 91 K+M R+I E+L++ S+ Sbjct: 46 KYMERVIKEVLRLYPSV 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,898 Number of Sequences: 336 Number of extensions: 3438 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -