BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B13 (720 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 28 1.2 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.6 SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosacchar... 25 8.2 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 28.3 bits (60), Expect = 1.2 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = -1 Query: 411 SSTGKSLKTATSSTMLRSLNTSRRNS*VSKPIRFVASRVTPRTSSGS*PRTTGKTCLS 238 SST S +SS SLN++ + S I S TP TSS S T + S Sbjct: 214 SSTAASNSATSSSLASSSLNSTTSATATSSSISSTVSSSTPLTSSNSTTAATSASATS 271 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 361 ITQYIEEEFVSQQADTIRSLAGHTSDLKRFITENNG 254 I Q +++FV + + L + + KR +TENNG Sbjct: 327 IRQLEQQKFVEIASQRAKELDVYMEEFKRSLTENNG 362 >SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.4 bits (53), Expect = 8.2 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = -3 Query: 715 ALASXYLKRSY-HYLLSASYFNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKM 539 ALAS ++ + + L S S FN Y + +L++ E + ++KHV K + Sbjct: 635 ALASSNIETEFLNALESVSEFNEYGPVLKSSPSPI-ELTEQETEFVVKVVKHVFKDHLVV 693 Query: 538 DFSSHTTL 515 F H TL Sbjct: 694 QFQLHNTL 701 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,687,712 Number of Sequences: 5004 Number of extensions: 51640 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -