BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B13 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 28 0.33 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 28 0.33 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 5.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.2 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 9.5 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 27.9 bits (59), Expect = 0.33 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 317 IGLLTHEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 463 IG +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 250 IGGHSHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 27.9 bits (59), Expect = 0.33 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 317 IGLLTHEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 463 IG +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 250 IGGHSHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 5.4 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -3 Query: 247 LSLAVYLFDEYLQKVV*TKF*NPIQFYHLVVFFFKQATLNF*VQIWLFNC 98 LSL + L YLQ QF H ++ A LN +W NC Sbjct: 213 LSLVIILSQYYLQP--------DFQFCHTFAYYHIIAMLNGFCSLWFVNC 254 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 655 NNYQTNREGFAKLFRKLSDDSWE 587 NN+QT + LFR + ++W+ Sbjct: 1346 NNFQTFPQAVLVLFRSATGEAWQ 1368 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 659 LQQLPDEQGRIREALQEIIGRFVGE 585 L + PD QGR+RE ++ + GE Sbjct: 327 LAKNPDIQGRLREEIERAVEENGGE 351 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,818 Number of Sequences: 2352 Number of extensions: 12956 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -