BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B10 (410 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.09 |tim21||mitochondrial inner membrane presequence tra... 29 0.28 SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyc... 27 0.86 SPAC24B11.06c |sty1|spc1, phh1|MAP kinase Sty1|Schizosaccharomyc... 27 1.1 SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p... 25 3.5 SPBC21D10.07 |||UPF0287 family protein|Schizosaccharomyces pombe... 25 3.5 SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre... 25 4.6 SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S... 25 4.6 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 25 4.6 SPAC8F11.05c |mug130||sequence orphan|Schizosaccharomyces pombe|... 25 6.1 SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyc... 24 8.0 >SPBC1289.09 |tim21||mitochondrial inner membrane presequence translocase complex subunit Tim21 |Schizosaccharomyces pombe|chr 2|||Manual Length = 223 Score = 29.1 bits (62), Expect = 0.28 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 268 GMISHQLLGRCQKEEARYMDCLEAYGLERGKVKCAHLFGDY 146 G+I + L+ K EA Y D EA+ L + +C ++FGD+ Sbjct: 84 GLIIYALVTSIWKGEAHYGD--EAFELLKANEECRYVFGDH 122 >SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyces pombe|chr 1|||Manual Length = 721 Score = 27.5 bits (58), Expect = 0.86 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 222 ASSFWQRPRSWWEIMPPVTSVN 287 A++ W ++WW+I PP+ VN Sbjct: 203 AAAIWATGQTWWQI-PPIARVN 223 >SPAC24B11.06c |sty1|spc1, phh1|MAP kinase Sty1|Schizosaccharomyces pombe|chr 1|||Manual Length = 349 Score = 27.1 bits (57), Expect = 1.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 334 LSSENIMSLSPFFRSPFTDV 275 L ENI+SLS F SPF D+ Sbjct: 74 LRHENIISLSDIFISPFEDI 93 >SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 25.4 bits (53), Expect = 3.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 234 WQRPRSWWEIMPP 272 W+R RS W+I PP Sbjct: 128 WKRKRSLWDIKPP 140 >SPBC21D10.07 |||UPF0287 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 104 Score = 25.4 bits (53), Expect = 3.5 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -2 Query: 190 LERGKVKCAHLFGDYH-ECSTLTKQLKRFLAIRHERQRQISXRKTYRRRKVCE 35 L R +C FG + EC+T+ +LK L + +++ R+KV E Sbjct: 16 LIRALEECHKSFGKFFGECNTIKYELKACLTKDRNDKARLNRENARMRKKVIE 68 >SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre1|Schizosaccharomyces pombe|chr 2|||Manual Length = 900 Score = 25.0 bits (52), Expect = 4.6 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 373 IKLSVFEYF*-DFGLSSENIMSLSPFFRSPFT 281 + L +F YF D S + +L PF SPFT Sbjct: 411 VGLGLFNYFGNDSSQSVYGLFALPPFLMSPFT 442 >SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2337 Score = 25.0 bits (52), Expect = 4.6 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = -2 Query: 196 YGLERGKVKCAHLFGDYHECSTLTKQLKRFLAIRHERQRQIS 71 + + GK++C H G++ S L ++ ++ H+ +R I+ Sbjct: 1324 FEITMGKLRCLHALGEWDRLSQLAQE--NWIHAGHDARRYIA 1363 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 25.0 bits (52), Expect = 4.6 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -1 Query: 290 TVYGCYWWH----DFPPTSGSLPERGSQIHGLSRSLWFGTRKGQV 168 TV G WH D TS S R +WFGTR G + Sbjct: 486 TVTGLCHWHMPLGDTKVTSLSFKSSPENYSDDGRFVWFGTRDGML 530 >SPAC8F11.05c |mug130||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 241 Score = 24.6 bits (51), Expect = 6.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 287 VYGCYWWHDFPPTSGSLPERGSQIHGLSR 201 V C W D P +G E+GS + ++R Sbjct: 213 VQDCAMWPDGYPGTGRESEKGSNLEAITR 241 >SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyces pombe|chr 2|||Manual Length = 503 Score = 24.2 bits (50), Expect = 8.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 253 QLLGRCQKEEARYMDCLEAYGL 188 QL CQ EE +Y +E YGL Sbjct: 328 QLYMDCQSEEHKYNVLVELYGL 349 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,734,136 Number of Sequences: 5004 Number of extensions: 34489 Number of successful extensions: 82 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 142254980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -