BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B08 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 4.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.3 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 7.0 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 201 ETKQIPSTIAAMTEKQLLCEGR 136 +T QI ST+ T + LLC R Sbjct: 1411 DTAQISSTVQKYTLENLLCGSR 1432 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 5.3 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 5 SETWLKPDFVFKIPGY 52 ++ WL+PD++F + Y Sbjct: 225 TKIWLRPDWLFNLTKY 240 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 176 IVDGICFVSIYVPHPSLQIFNEIKNLISVLPRPFMILG 289 +V +C+ + +V HP ++ + ++ ++ M++G Sbjct: 159 VVAEVCYFTAHVTHPRHRLCVFVAGVVFIVSGLLMLVG 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,879 Number of Sequences: 438 Number of extensions: 4130 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -