BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B08 (745 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01660.1 68418.m00082 kelch repeat-containing protein similar... 29 4.3 At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 29 4.3 At5g48880.2 68418.m06047 acetyl-CoA C-acyltransferase 1 / 3-keto... 28 5.7 At5g37910.1 68418.m04567 seven in absentia (SINA) family protein... 28 7.5 At4g31210.1 68417.m04432 DNA topoisomerase family protein simila... 27 9.9 >At5g01660.1 68418.m00082 kelch repeat-containing protein similar to SP|P57790 Kelch-like ECH-associated protein 1 (Cytosolic inhibitor of Nrf2) {Rattus norvegicus}; contains Pfam profile PF01344: Kelch motif Length = 621 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 179 VDGICFVSIYVPHPSLQIFNEIKNL 253 +DG C VS +PH Q+ +E+K L Sbjct: 247 IDGSCLVSSPLPHTISQLMHEVKEL 271 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -2 Query: 195 KQIPSTIAAMTEKQLLCEGRGKEEKVLEFLMSR 97 K++ +++AA Q++C GKE++++ +SR Sbjct: 164 KELSASMAARKSLQMMCSSLGKEKEIMALELSR 196 >At5g48880.2 68418.m06047 acetyl-CoA C-acyltransferase 1 / 3-ketoacyl-CoA thiolase 1 (PKT1) identical to 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana] GI:3169568 Length = 457 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 108 LMSRHTPPYPSALSSLKHE*PGILNTKSGFSQVS 7 ++ RH P S+ SSLKHE P +L+ + S+VS Sbjct: 10 ILLRHLNPVSSSNSSLKHE-PSLLSPVNCVSEVS 42 >At5g37910.1 68418.m04567 seven in absentia (SINA) family protein similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 276 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 537 HFPETHATVIWRNIKRFRSA 596 H+ TH+T I+ NIKRFR A Sbjct: 143 HYKLTHSTNIFWNIKRFRCA 162 >At4g31210.1 68417.m04432 DNA topoisomerase family protein similar to DNA Topoisomerase I (SP:Q9X3X7) {Zymomonas mobilis} Length = 1280 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 251 LISVLPRPFMILGDFNSHHTSWGSSVSNSYGY 346 L LP +LG S+ T W SS S ++GY Sbjct: 69 LACALPSHLSLLGSL-SYATHWSSSTSRAFGY 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,681,711 Number of Sequences: 28952 Number of extensions: 296950 Number of successful extensions: 743 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -