Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_pT_B07
         (504 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g55470.1 68418.m06909 sodium proton exchanger / Na+/H+ exchan...    27   5.4  

>At5g55470.1 68418.m06909 sodium proton exchanger / Na+/H+ exchanger
           4 (NHX4) identical to Na+/H+ exchanger 4 [Arabidopsis
           thaliana] GI:19919844; Member of The Monovalent
           Cation:Proton Antiporter (CPA1) Family, PMID:11500563
          Length = 529

 Score = 27.5 bits (58), Expect = 5.4
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = -2

Query: 314 LSLTILHAVHIYLLHILFSKQFEGVVFFCLLMFAIVLDYPTI*DNSKSNNNHI---LNFF 144
           L++ +L A   Y+L  LFS      VFFC ++ +    Y  + ++S+  + H+   L+F 
Sbjct: 251 LAIMVLMAYLSYMLAELFSLSGILTVFFCGVLMSHYASY-NVTESSRITSRHVFAMLSFI 309

Query: 143 ADNGPF*Y 120
           A+   F Y
Sbjct: 310 AETFIFLY 317


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,138,040
Number of Sequences: 28952
Number of extensions: 164579
Number of successful extensions: 325
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 323
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 325
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 898188928
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)