BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_B03 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.4 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.8 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 9.8 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 413 FCRK*YSFRIMISEAKALNIRIKLILTLYNSFINYMI 303 FC K Y ++ +K +N L L+ F NY+I Sbjct: 457 FCCKGYCMDLLKELSKTINFTYSLALSPDGQFGNYII 493 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 210 DHKDIIFNRKSGYIEKIWLNLYIYFYL*SFVF 115 +H + N+ + +IE I LN Y +F +F F Sbjct: 211 NHDYNLENKLNYFIEDIGLNTYYFFLRQAFPF 242 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 210 DHKDIIFNRKSGYIEKIWLNLYIYFYL*SFVF 115 +H + N+ +IE I LN Y +F +F F Sbjct: 211 NHDYNLENKLIYFIEDIGLNTYYFFLRQAFPF 242 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 156 LNLYIYFYL*SFVFVCIIY*MKNKYNYVDYLHFI 55 L LYI+F + + + I+ + + YVD H I Sbjct: 481 LQLYIFFLVTTAGTIGILMDAPHIFEYVDQDHII 514 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.0 bits (42), Expect = 9.8 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +2 Query: 251 IFYELFRYYTFLCLKFE 301 +FYE+FRY ++++ Sbjct: 48 VFYEVFRYLELAMIRWK 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,699 Number of Sequences: 438 Number of extensions: 3813 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -