BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A24 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.57 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 25 0.76 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 23 4.0 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.3 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 9.3 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.3 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.4 bits (53), Expect = 0.57 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 129 ILFIWLLALCLCV 91 I+ IWLLALCL V Sbjct: 175 IIVIWLLALCLAV 187 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 25.0 bits (52), Expect = 0.76 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 254 QKVKEEEVEA*TS*YPNH*DLSPTVNNYVMCPIVCLSAKRLKFYLSGC-LRCV 99 ++++EE +E T ++ L P + V C ++ +K L S C +RC+ Sbjct: 34 RQIEEENIEPDTELMDSNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIRCL 86 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 129 ILFIWLLALCLCVSKPDI*VKFKQLPVLSYQSFCVFQR 16 +LF +LAL ++ DI K P + Q C+ R Sbjct: 6 LLFFTILALINVKAQDDISKFLKDRPYVQKQLHCILDR 43 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 595 LTTPTKILLRGFAKTTMNASLVLKMKNSIWN 503 + P LL GF ++T + + ++ N WN Sbjct: 18 MLAPINALLLGFVQSTPDNNKTVREFNVYWN 48 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.3 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -2 Query: 459 PSQRPQRQIRQAHTKEGF---QIRKQIRQAPEEGRRIQLP*PIEGREKEGIHLGRGRQ 295 P P++Q +QA +G + +Q + AP+ LP P+ + RGRQ Sbjct: 219 PGMHPRQQ-QQAQQHQGVVTSPLSQQQQAAPQGAASANLPSPLYPWMRSQFERKRGRQ 275 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 367 AFFWSLANL--FSYLETFFSVGLTNLPLRSLTWEFRSE 474 +F + +A L F+ + F VG +PL WE +E Sbjct: 314 SFGYCIATLLEFAGVHYFTKVGSGEIPLEEEEWENENE 351 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 9.3 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 350 RNQLKVVKKKEFTLEEEDKEKKPDWSKGKP-GDQKVKEEE 234 RNQ K V + F ++ + +P S G+P G ++ +E E Sbjct: 446 RNQRKNVLDRLFRMDRDAVYLQPGMSFGEPLGLRRPQERE 485 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,052 Number of Sequences: 438 Number of extensions: 2771 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -