BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A23 (513 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1442.03 ||SPCC1450.19|ATP-Mg/Pi carrier homolog|Schizosaccha... 26 2.9 SPBC1683.04 |||glycosyl hydrolase family 3|Schizosaccharomyces p... 26 2.9 SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 25 8.8 SPCC16C4.09 |sts5|orb4|RNB-like protein|Schizosaccharomyces pomb... 25 8.8 SPAC17H9.17c |mdm10||Mdm10/Mdm12/Mmm1 complex subunit Mdm10 |Sch... 25 8.8 SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Sch... 25 8.8 >SPCC1442.03 ||SPCC1450.19|ATP-Mg/Pi carrier homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 338 Score = 26.2 bits (55), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 154 SGRALVFYEYFRELVDKECSSQ 219 SG L+FYE R++ KEC + Sbjct: 189 SGFQLLFYEKLRQVAQKECGQK 210 >SPBC1683.04 |||glycosyl hydrolase family 3|Schizosaccharomyces pombe|chr 2|||Manual Length = 832 Score = 26.2 bits (55), Expect = 2.9 Identities = 12/38 (31%), Positives = 25/38 (65%) Frame = -3 Query: 319 LQRVEVPVIQYNTNQFSTVTEEACAAPGKRNLMPGTNT 206 L R+E+ I+Y T+ + + E+ C+ G+ N++ GT++ Sbjct: 776 LIRIELD-IKYATSFYDELNEKWCSEEGEYNVLVGTSS 812 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 24.6 bits (51), Expect = 8.8 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -3 Query: 361 SNLQAPL-FPVAPIALQRVEVPVIQYNTNQFSTVTEEACAAPGKRNLMPGTNTPYPPVPE 185 + L +P+ P A A+Q + PV ++ + V + AA G N P PE Sbjct: 266 NTLASPVTLPAANSAVQNAQ-PVPMTSSPAMAVVPQNKTAATSTLAAQQGANVLPPNAPE 324 Query: 184 NIR 176 ++R Sbjct: 325 SVR 327 >SPCC16C4.09 |sts5|orb4|RNB-like protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1066 Score = 24.6 bits (51), Expect = 8.8 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -2 Query: 419 IV*QNVSSTRPNYW*THCSFKSTGSTIPCSTHSPTTGGGSCNP 291 IV N S+ RP H +STGS S+ S + GGS NP Sbjct: 241 IVTHNTSNFRPEGG-GHRHRRSTGSLSVGSSGSGFSSGGSGNP 282 >SPAC17H9.17c |mdm10||Mdm10/Mdm12/Mmm1 complex subunit Mdm10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 370 Score = 24.6 bits (51), Expect = 8.8 Identities = 22/92 (23%), Positives = 34/92 (36%), Gaps = 1/92 (1%) Frame = -3 Query: 415 YSKMYHQLGRITGRLIAASNLQAPLFPVAPIALQRVEVPVIQYNTNQFSTVTEEACAAPG 236 + Y L + G + P P AP L P++ + T+ FST A Sbjct: 222 FETYYGVLTKCAGASLGMRLHSGPSHPYAPFILTCTLNPIVGHITSTFSTAEPRTKAFSA 281 Query: 235 KRNL-MPGTNTPYPPVPENIRRKQELFQRDND 143 + + + + E R KQE+ Q ND Sbjct: 282 QYDFNIYSYESQLKLGIELWRSKQEMSQSTND 313 >SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Schizosaccharomyces pombe|chr 1|||Manual Length = 938 Score = 24.6 bits (51), Expect = 8.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 253 ACAAPGKRNLMPGTNTPYPPVPEN 182 A AP N ++T PPVPEN Sbjct: 444 ALKAPAPENKPEKSSTSKPPVPEN 467 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,310,389 Number of Sequences: 5004 Number of extensions: 48744 Number of successful extensions: 148 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 206265012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -