BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A23 (513 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0571 - 4233769-4234239,4234340-4234378,4234712-4234839,423... 30 1.3 07_03_0025 + 12587868-12588429,12591820-12592031,12592212-125926... 29 1.7 11_04_0423 - 17498569-17498932,17499217-17499992,17503439-17504617 29 2.9 12_02_0445 - 19153580-19154269 28 3.8 11_06_0153 - 20693663-20693689,20693808-20694096,20694493-206948... 28 5.1 02_02_0489 + 10869482-10871218 28 5.1 11_04_0432 + 17693438-17693612,17693782-17694125,17695210-17695524 27 6.7 10_02_0078 - 4992019-4992594,4993156-4993248,4995984-4996202,499... 27 6.7 05_06_0186 - 26207298-26208548,26208743-26208853,26209286-262095... 27 6.7 03_05_0244 - 22295105-22295389 27 6.7 01_06_1518 + 37925609-37925871,37925954-37926554 27 6.7 11_02_0045 - 7705728-7707581 27 8.8 06_02_0272 + 13646814-13647305,13647983-13648612 27 8.8 05_04_0399 - 20955319-20955838,20955939-20956201 27 8.8 03_05_0955 + 29168771-29170507 27 8.8 02_05_1261 + 35305909-35307042,35307779-35307968,35308550-35308818 27 8.8 01_05_0694 - 24347642-24348246,24349915-24349993,24350473-243506... 27 8.8 >01_01_0571 - 4233769-4234239,4234340-4234378,4234712-4234839, 4235329-4235470,4235519-4235905,4236045-4236230, 4236382-4236659,4236757-4236883,4237270-4237442, 4237610-4237657,4237734-4237767,4237837-4237965, 4238865-4238960,4239419-4239485,4240030-4240085, 4240522-4240617,4241127-4242222,4243221-4243402 Length = 1244 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 71 ESAEKQSQTIQYNVSRSTF*EDGQVIVSLEELLFSTNIFG 190 E A K + + Y+V R+ DGQ +V+LE +FS N G Sbjct: 661 EDALKNGEVLAYHVYRTCLRMDGQTLVNLE--IFSNNFDG 698 >07_03_0025 + 12587868-12588429,12591820-12592031,12592212-12592603, 12592608-12592965 Length = 507 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -3 Query: 214 TNTPYPPVPENIRRKQELFQRDNDLPVFLKG 122 T+TP+PP+ +RR+ + R+ +LP + KG Sbjct: 363 TSTPHPPLLHPLRRRSDSAFRECELPRYGKG 393 >11_04_0423 - 17498569-17498932,17499217-17499992,17503439-17504617 Length = 772 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = -3 Query: 322 ALQRVEVPVIQYNTNQFSTVTEEACAAPGKRNLMPGTNTPYPPVPENIRRKQELFQ 155 ++QRV + S ++ A+P R P+PP PE ++ Q L+Q Sbjct: 437 SMQRVASHFADALAARLSLLSSPTSASPSPRAAAAAAPYPFPPSPETLKVYQILYQ 492 >12_02_0445 - 19153580-19154269 Length = 229 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 259 EEACAAPGKRNLMPGTNTPYPPVPENIRRKQELFQRDNDLPVFLKGGPA 113 +E PG MP + P+PP P +L +R+ P + GPA Sbjct: 12 DEELPRPGLPPTMPDDDPPFPPCPARSPAAPKLSRRERGAP---RDGPA 57 >11_06_0153 - 20693663-20693689,20693808-20694096,20694493-20694829, 20695304-20696516,20700247-20700744 Length = 787 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 277 QFSTVTEEACAAPGKRNLMPGTNTPYPPVPENI 179 QFS +++ P N MPGT P P P +I Sbjct: 439 QFSEISQAKSHVPPADNDMPGTLVPRSPDPNSI 471 >02_02_0489 + 10869482-10871218 Length = 578 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 69 PRAQRSKVRRYSITSAGPPFRKTGKSLSLWKSSCFLRI 182 P KV +Y++ P K+GK+LS W + ++I Sbjct: 174 PAPSTGKVSKYNLAPEPSPSSKSGKALSRWTTDDEVKI 211 >11_04_0432 + 17693438-17693612,17693782-17694125,17695210-17695524 Length = 277 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 407 NVSSTRPNYW*THCSFKSTGST-IPCSTHSPTTGGGSCNP 291 N SS + W F+ G+T IPC P TG GS P Sbjct: 125 NSSSAKRTEWVMQ-EFRLAGATLIPCPVTRPATGDGSMLP 163 >10_02_0078 - 4992019-4992594,4993156-4993248,4995984-4996202, 4996282-4996345,4996429-4996485,4996573-4996671, 4997296-4997327 Length = 379 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = -3 Query: 301 PVIQYNTNQFSTVTEEACAAPGKRNLMPGTNTPYPPVPENIRRKQELFQRDNDLPV 134 PV ++ TEEA +P MPG+ PP+P++ + ++ + D+P+ Sbjct: 285 PVEDLKSSGMKLATEEA-PSPSSNAAMPGSEPSAPPLPKS--AEDDMSIDEVDIPI 337 >05_06_0186 - 26207298-26208548,26208743-26208853,26209286-26209507, 26209623-26209658 Length = 539 Score = 27.5 bits (58), Expect = 6.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 226 LMPGTNTPYPPVPENIRRKQ 167 L+PG TP+PP P+ R ++ Sbjct: 27 LLPGNRTPHPPPPQGSRPRK 46 >03_05_0244 - 22295105-22295389 Length = 94 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 356 STGSTIPCSTHSPTTGGGSCNPVQYQPVL 270 S+ ST+P S SP GGG C+ +L Sbjct: 8 SSSSTLPSSPLSPGGGGGGCSVAYSSAIL 36 >01_06_1518 + 37925609-37925871,37925954-37926554 Length = 287 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 386 NYW*THCSFKSTGSTIPCSTHSPTTGGGS 300 NYW TH K I TH P + G S Sbjct: 106 NYWNTHIKRKLLSRGIDPQTHRPVSAGSS 134 >11_02_0045 - 7705728-7707581 Length = 617 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 164 LLFSTNIFGNWWIRSVRP-RHQIPFSRCGTSFFG 262 LL N+FGN W++++ RHQ + SFFG Sbjct: 353 LLSKYNLFGNEWLQTIYSIRHQWVPAYLKDSFFG 386 >06_02_0272 + 13646814-13647305,13647983-13648612 Length = 373 Score = 27.1 bits (57), Expect = 8.8 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 274 FSTVTE-EACAAPGKRNLMPGTNTPYPPVPENIRRKQELFQRDNDLPVFLKGG 119 FST +A G+ N P P PP P + L Q + LP+FL GG Sbjct: 270 FSTTAHMDASFGTGQYNPAPLAVEPPPPPPAFFPSLRSL-QENLQLPLFLSGG 321 >05_04_0399 - 20955319-20955838,20955939-20956201 Length = 260 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 386 NYW*THCSFKSTGSTIPCSTHSPTTGGG 303 NYW TH K I TH P GG Sbjct: 106 NYWNTHIKRKLLARGIDPQTHRPLLSGG 133 >03_05_0955 + 29168771-29170507 Length = 578 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 356 STGSTIPCSTHSPTTGGGSCNPVQYQPVLDCDR 258 + + + CS+ SP++ SC+ Q +L C R Sbjct: 184 AAATPVACSSPSPSSADASCSAPILQSLLSCSR 216 >02_05_1261 + 35305909-35307042,35307779-35307968,35308550-35308818 Length = 530 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +3 Query: 207 VFVPGIRFLFPGAAQASSVTVENWLVLYWITGTSTRCRAMGATGNSGAC 353 V + G R AA + + WL+L W++ + +G+ N C Sbjct: 442 VLLLGARVAASAAAISPAAETNAWLILAWVSTVAGNLSLLGSAANLIVC 490 >01_05_0694 - 24347642-24348246,24349915-24349993,24350473-24350607, 24351486-24351578,24351801-24351926,24352285-24352332, 24352552-24352653,24353234-24353317,24353754-24353825, 24354136-24354292,24354520-24354563,24354806-24354918, 24355252-24355368,24356330-24356399 Length = 614 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 219 LGRTLLIHQFPKIFVENKSSSRETMTCPSS*KVDLLT 109 +G T+ PK+ + N S RET P+S V +T Sbjct: 258 IGETIASRSIPKVLLLNGSHDRETTGLPASGFVTAIT 294 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,431,261 Number of Sequences: 37544 Number of extensions: 338714 Number of successful extensions: 1089 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -