BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A23 (513 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58760.1 68418.m07360 transducin family protein / WD-40 repea... 30 1.1 At3g55710.1 68416.m06189 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.6 At1g11350.1 68414.m01303 S-locus lectin protein kinase family pr... 27 5.6 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 27 7.4 At3g54630.1 68416.m06044 expressed protein weak similarity to re... 27 7.4 At2g32290.1 68415.m03947 beta-amylase, putative / 1,4-alpha-D-gl... 27 7.4 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 27 9.8 >At5g58760.1 68418.m07360 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); damage-specific DNA binding protein 2 (GI:10798819) [Homo sapiens] Length = 557 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -2 Query: 371 HCSFKSTGSTIPCSTHSPTTGGGSCNPVQYQPVLDCDRRSLCRTW 237 H + STG I G CNPVQ + +L C R W Sbjct: 296 HRTNNSTGEPILIHKQGSKVCGLDCNPVQPELLLSCGNDHFARIW 340 >At3g55710.1 68416.m06189 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 464 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 361 SNLQAPLFPVAPIALQRVEVP 299 S LQ PLFP+ P R ++P Sbjct: 226 SKLQVPLFPIGPFHKHRTDLP 246 >At1g11350.1 68414.m01303 S-locus lectin protein kinase family protein contains Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 830 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +3 Query: 258 SVTVENWLVLYWITGTSTRCRAMGATGNSGACRFEAAMSLP 380 +V ++ W W+ ST+C G +CRF + P Sbjct: 270 NVAIQEWKT--WLKVPSTKCDTYATCGQFASCRFNPGSTPP 308 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 286 NTNQFSTVTEEACAAPGKRNLMPGTNTPYPPVP 188 N F +T+E P R P TP PP P Sbjct: 352 NRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPP 384 >At3g54630.1 68416.m06044 expressed protein weak similarity to retinoblastoma-associated protein HEC [Homo sapiens] GI:2501873 Length = 568 Score = 27.1 bits (57), Expect = 7.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 244 APGKRNLMPGTNTPYPPVPENIRRKQELF-QRDNDLPVFLKGGPADV 107 A GKR G PP P +I +++ LF RD+D F P+ + Sbjct: 5 AAGKRRTTVGFGGAPPPPPPSIEQQRHLFNSRDSDAS-FASSRPSSI 50 >At2g32290.1 68415.m03947 beta-amylase, putative / 1,4-alpha-D-glucan maltohydrolase, putative similar to beta-amylase GI:13560977 from [Castanea crenata] Length = 577 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 11 LSCFLGLALGVDGLHYTYQSESAEKQSQTIQYNV 112 L C L +A V G+H+ Y++ES + YN+ Sbjct: 353 LGCKLKIAAKVSGIHWWYKTESHAAELTAGYYNL 386 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 319 LQRVEVPVIQYNTNQFSTVTEEACAAP 239 L R V V Y T+ F T+TE AAP Sbjct: 303 LVREAVTVGPYETDNFPTITEAVAAAP 329 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,220,106 Number of Sequences: 28952 Number of extensions: 261659 Number of successful extensions: 705 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -