BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A19 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.4 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 9.6 EF588645-1|ABQ96833.1| 161|Anopheles gambiae transposase protein. 23 9.6 EF588613-1|ABQ96804.1| 161|Anopheles gambiae transposase protein. 23 9.6 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 9.6 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 9.6 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 9.6 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 9 RRFFLLTRPGRPP-PNGDFREKSM 77 +R LL +PG+PP NG +R M Sbjct: 539 QRLVLLPKPGKPPGSNGSYRPLCM 562 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 113 DVHNLLADNYYQTNASYYENTNCFKTLNSTKL 208 D+ ++ Y+ Y+ NT+ +T+N KL Sbjct: 153 DLQGIVLPAIYEIYPYYFFNTDVIRTINYKKL 184 >EF588645-1|ABQ96833.1| 161|Anopheles gambiae transposase protein. Length = 161 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 216 LNFNFVEFNVLKQFVFS 166 L FN VE + K+FV+S Sbjct: 105 LPFNLVESEIFKKFVYS 121 >EF588613-1|ABQ96804.1| 161|Anopheles gambiae transposase protein. Length = 161 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 216 LNFNFVEFNVLKQFVFS 166 L FN VE + K+FV+S Sbjct: 105 LPFNLVESEIFKKFVYS 121 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 113 DVHNLLADNYYQTNASYYENTNCFKTLNSTKL 208 D+ ++ Y+ Y+ NT+ +T+N KL Sbjct: 153 DLQGIVLPAIYEIYPYYFFNTDVIRTINYKKL 184 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 113 DVHNLLADNYYQTNASYYENTNCFKTLNSTKL 208 D+ ++ Y+ Y+ NT+ +T+N KL Sbjct: 153 DLQGIVLPAIYEIYPYYFFNTDVIRTINYKKL 184 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 113 DVHNLLADNYYQTNASYYENTNCFKTLNSTKL 208 D+ ++ Y+ Y+ NT+ +T+N KL Sbjct: 153 DLQGIVLPAIYEIYPYYFFNTDVIRTINYKKL 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,208 Number of Sequences: 2352 Number of extensions: 14872 Number of successful extensions: 234 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 234 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -