BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A17 (592 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.5 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 4.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.8 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 582 TMVVYWWPPA 553 ++VVYW PPA Sbjct: 1011 SLVVYWKPPA 1020 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.8 bits (44), Expect = 4.5 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +1 Query: 43 YWLFDICHL 69 YWL ICH+ Sbjct: 108 YWLHQICHI 116 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -2 Query: 129 WKLKVNKTLRPKTISSLDRXKVTDVKQPIAATVSSP 22 W V LRPK + + + ++ +PI A P Sbjct: 102 WLQNVEPNLRPKLLLKHNLFLLDNIVKPIIAFYYKP 137 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,825 Number of Sequences: 336 Number of extensions: 2025 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -