SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_pT_A17
         (592 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    22   4.5  
AM292375-1|CAL23187.2|  311|Tribolium castaneum gustatory recept...    22   4.5  
DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    21   7.8  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -2

Query: 582  TMVVYWWPPA 553
            ++VVYW PPA
Sbjct: 1011 SLVVYWKPPA 1020


>AM292375-1|CAL23187.2|  311|Tribolium castaneum gustatory receptor
           candidate 54 protein.
          Length = 311

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 43  YWLFDICHL 69
           YWL  ICH+
Sbjct: 108 YWLHQICHI 116


>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 21.0 bits (42), Expect = 7.8
 Identities = 10/36 (27%), Positives = 16/36 (44%)
 Frame = -2

Query: 129 WKLKVNKTLRPKTISSLDRXKVTDVKQPIAATVSSP 22
           W   V   LRPK +   +   + ++ +PI A    P
Sbjct: 102 WLQNVEPNLRPKLLLKHNLFLLDNIVKPIIAFYYKP 137


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,825
Number of Sequences: 336
Number of extensions: 2025
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14830622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -