BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A16 (608 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0315 - 20139544-20140545,20140674-20141547,20142313-20142320 29 3.8 08_01_0304 - 2502760-2502774,2502844-2502921,2503035-2503103,250... 28 6.7 >05_04_0315 - 20139544-20140545,20140674-20141547,20142313-20142320 Length = 627 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -2 Query: 271 HPSNRNSLLLHGRNKQGGGTYPRGLRRCP--TTSDYANYNFAGLI 143 HP L L N G +P GL+ C T D ++ NF GLI Sbjct: 90 HPDENRVLSLRLGNLGLQGPFPAGLQNCTSMTGLDLSSNNFTGLI 134 >08_01_0304 - 2502760-2502774,2502844-2502921,2503035-2503103, 2503200-2503289,2503400-2503517,2505548-2505678, 2505756-2506025,2507175-2507308,2507635-2508088 Length = 452 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 Query: 2 KPSGAFV*XRCTGVRIPQAGTNFSNEIRTQQMFTIDFRGE 121 K G + RCTGV I G N +I T DF GE Sbjct: 150 KKDGGGLISRCTGVVIGWDGANKRAKILTAASVVCDFHGE 189 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,321,615 Number of Sequences: 37544 Number of extensions: 367988 Number of successful extensions: 681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -