BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A15 (451 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 24 0.57 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 24.2 bits (50), Expect = 0.57 Identities = 21/77 (27%), Positives = 39/77 (50%) Frame = -2 Query: 285 IRQDNDNIGVEGYNTGYETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVT 106 ++ DN N G EG+ T E+ G + T Q++ T+ + + F + G + V+ V+ Sbjct: 235 LKHDNSNEGGEGFATVEESEIG---KNTKQVEL--TDEKIVAQALLFFFAGFETVSTGVS 289 Query: 105 YVANEGGFQPSAPHIPK 55 ++A E + PH+ K Sbjct: 290 FMAYE---LATNPHVQK 303 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,219 Number of Sequences: 336 Number of extensions: 1135 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -