BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A15 (451 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 30 0.043 AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding pr... 22 8.7 AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 22 8.7 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.9 bits (64), Expect = 0.043 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 237 YETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVTYVAN 94 YE S + + TG +KN EV G+++ + DG V Y A+ Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHAD 131 >AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding protein AgamOBP56 protein. Length = 181 Score = 22.2 bits (45), Expect = 8.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 25 LAGACSVDLSLGNVRCRRLESTLVSD 102 +A AC D + N RC R+ L ++ Sbjct: 143 MALACPKDKQVANKRCDRIREKLANN 168 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 22.2 bits (45), Expect = 8.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 25 LAGACSVDLSLGNVRCRRLESTLVSD 102 +A AC D + N RC R+ L ++ Sbjct: 197 MALACPKDKQVANKRCDRIREKLANN 222 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 350,614 Number of Sequences: 2352 Number of extensions: 5288 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38268990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -