BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A13 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 3.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 9.9 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 9.9 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 384 KASSTLYIGNLSFYTTEEQIYELYSRCGDIRR 289 + +S L I + F T EE + SRCG+I R Sbjct: 41 ECASLLAIYSKRFTTPEETQFLASSRCGEIGR 72 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 132 Q*IQHPSHSELFCHPASCHLYTSYNFRHLPAH 227 Q + HP+H HPA H + ++ P+H Sbjct: 176 QHVLHPAHHPALLHPA-YHTGLHHYYQPSPSH 206 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 132 Q*IQHPSHSELFCHPASCHLYTSYNFRHLPAH 227 Q + HP+H HPA H + ++ P+H Sbjct: 176 QHVLHPAHHPALLHPA-YHTGLHHYYQPSPSH 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,866 Number of Sequences: 2352 Number of extensions: 9925 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -