BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A12 (301 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC065199-1|AAH65199.1| 453|Homo sapiens family with sequence si... 29 3.5 BC037572-1|AAH37572.1| 453|Homo sapiens family with sequence si... 29 3.5 AF123073-1|AAK01477.1| 453|Homo sapiens C/EBP-induced protein p... 29 3.5 >BC065199-1|AAH65199.1| 453|Homo sapiens family with sequence similarity 117, member A protein. Length = 453 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 192 KPNSLSHPAGVERGLPSPALCPAGTMKPWRLFI 94 K +S HPA +E G PSP L A + +P +I Sbjct: 303 KASSPGHPAFLEDGSPSPVLAFAASPRPNHSYI 335 >BC037572-1|AAH37572.1| 453|Homo sapiens family with sequence similarity 117, member A protein. Length = 453 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 192 KPNSLSHPAGVERGLPSPALCPAGTMKPWRLFI 94 K +S HPA +E G PSP L A + +P +I Sbjct: 303 KASSPGHPAFLEDGSPSPVLAFAASPRPNHSYI 335 >AF123073-1|AAK01477.1| 453|Homo sapiens C/EBP-induced protein protein. Length = 453 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 192 KPNSLSHPAGVERGLPSPALCPAGTMKPWRLFI 94 K +S HPA +E G PSP L A + +P +I Sbjct: 303 KASSPGHPAFLEDGSPSPVLAFAASPRPNHSYI 335 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,569,578 Number of Sequences: 237096 Number of extensions: 1033442 Number of successful extensions: 2444 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 76,859,062 effective HSP length: 76 effective length of database: 58,839,766 effective search space used: 1353314618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -