BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A07 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 71 5e-14 AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 pr... 58 3e-10 AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 pr... 58 3e-10 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 52 1e-08 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 51 4e-08 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 51 4e-08 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 48 2e-07 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 47 7e-07 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 47 7e-07 AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 46 9e-07 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 46 9e-07 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 46 2e-06 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 46 2e-06 AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 45 3e-06 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 44 4e-06 AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 44 5e-06 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 44 5e-06 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 44 6e-06 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 44 6e-06 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 43 8e-06 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 42 1e-05 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 42 1e-05 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 42 1e-05 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 42 2e-05 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 42 2e-05 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 41 4e-05 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 40 6e-05 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 40 6e-05 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 40 6e-05 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 40 6e-05 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 40 8e-05 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 40 1e-04 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 38 2e-04 AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 pr... 38 2e-04 AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 pr... 38 3e-04 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 38 3e-04 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 38 3e-04 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 38 4e-04 AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CY... 37 5e-04 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 37 5e-04 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 37 5e-04 AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 pr... 35 0.003 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 35 0.003 AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CY... 34 0.005 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 34 0.005 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 34 0.005 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 33 0.007 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 33 0.007 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 33 0.007 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 33 0.011 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 33 0.011 AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 pr... 32 0.020 AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CY... 32 0.020 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 32 0.020 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 31 0.026 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 31 0.026 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 31 0.026 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 31 0.046 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 29 0.11 AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CY... 29 0.11 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 29 0.19 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 26 1.3 AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 25 2.3 AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 25 3.0 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 70.5 bits (165), Expect = 5e-14 Identities = 33/73 (45%), Positives = 50/73 (68%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 RS R F+PFSAG R+C+G +YAML +KV+LS+ILR R+ SDL+ +D + + D+ L Sbjct: 191 RSEGRSTNVFIPFSAGSRNCIGGRYAMLSMKVMLSSILRRLRLRSDLQMNDLQFRFDLTL 250 Query: 519 KRAEGFQVRLQPR 481 K + V+++ R Sbjct: 251 KLESEYFVQVEKR 263 >AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 protein. Length = 107 Score = 58.0 bits (134), Expect = 3e-10 Identities = 24/67 (35%), Positives = 44/67 (65%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQ 499 YAF+PFSAGPR+C+G K+A +++K +++ +L+NF + + + + + L+ G Sbjct: 41 YAFLPFSAGPRNCIGYKFAYIEMKTVIARVLQNFHLSPAPGKEEVQPIFRMTLRARGGLW 100 Query: 498 VRLQPRK 478 V++ PRK Sbjct: 101 VKMTPRK 107 >AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 58.0 bits (134), Expect = 3e-10 Identities = 23/47 (48%), Positives = 35/47 (74%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDL 559 R+A RH Y F+PFSAGPR+C+G +Y ++ +KV+L +L +R +DL Sbjct: 40 RTAHRHPYCFLPFSAGPRNCIGYRYGLMSMKVMLCHLLAAYRFSTDL 86 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 52.4 bits (120), Expect = 1e-08 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDF--KLQADIILKR 514 R+ +A++PFSAG R+C+G K+A+ +LK L ILR +V +L + DF K++ +++LK Sbjct: 41 RNPFAYIPFSAGSRNCIGQKFALNELKTALVKILRQCKV--ELPDPDFVPKMKMELVLKP 98 Query: 513 AEG 505 G Sbjct: 99 VNG 101 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 50.8 bits (116), Expect = 4e-08 Identities = 19/38 (50%), Positives = 28/38 (73%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 RH Y F+PF GPR C+G ++ +++ K+ L T+LRNFR Sbjct: 436 RHPYVFLPFGEGPRICIGLRFGVMQAKIGLITLLRNFR 473 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 50.8 bits (116), Expect = 4e-08 Identities = 19/66 (28%), Positives = 42/66 (63%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQ 499 Y ++PFS G R+C+G +YA+L++KV + ++ +R++ + +L+ D++L+ + Sbjct: 127 YDYIPFSIGSRNCIGQRYALLEMKVAIVRMVSFYRILPGDTMHEIRLKTDLVLRPDKSIP 186 Query: 498 VRLQPR 481 ++L R Sbjct: 187 IKLVAR 192 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 48.4 bits (110), Expect = 2e-07 Identities = 18/38 (47%), Positives = 27/38 (71%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 RH + F+PF GPR C+G ++ +++ KV L T+LR FR Sbjct: 439 RHPFTFIPFGEGPRICIGLRFGLMQTKVGLITLLRKFR 476 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 46.8 bits (106), Expect = 7e-07 Identities = 23/57 (40%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV-ISDLKESDFKLQADIILKRA 511 Y ++PFSAG R+C+G K+A +LK L +L+ F++ ++D L+A+I+LK A Sbjct: 116 YTYIPFSAGSRNCIGQKFAQYELKSTLVKLLQRFQIRLADASYVPI-LKAEIVLKPA 171 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 46.8 bits (106), Expect = 7e-07 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 3/73 (4%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD--- 529 R A R A++PF GPR C+G ++ M++ ++ L+ +L++F+V+ KE+D L Sbjct: 436 RMARRDPCAYLPFGEGPRICIGLRFGMMQARIGLALLLKHFQVL-PCKETDVPLTYSPRA 494 Query: 528 IILKRAEGFQVRL 490 +L G ++RL Sbjct: 495 FVLTPVNGVRLRL 507 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 46.4 bits (105), Expect = 9e-07 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVI 568 Y+++PFS G RSC+G ++AML++K +L +L FR + Sbjct: 70 YSYLPFSTGVRSCIGQRFAMLEMKTVLVRLLSRFRFV 106 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 46.4 bits (105), Expect = 9e-07 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 3/74 (4%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLK---ESDFKLQAD 529 + A RH YA+ PF GPR C+G ++ M++ ++ L+ +L FR K +F +++ Sbjct: 365 QEAKRHPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLTGFRFTPSAKTIVPMEFDIKS- 423 Query: 528 IILKRAEGFQVRLQ 487 IL A G ++++ Sbjct: 424 FILSPAGGLWLKVE 437 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 45.6 bits (103), Expect = 2e-06 Identities = 18/42 (42%), Positives = 28/42 (66%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + A RH YA+ PF GPR CVG ++ M++ ++ L+ +L FR Sbjct: 425 QEAKRHPYAWTPFGEGPRICVGLRFGMMQARIGLAYLLDGFR 466 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 45.6 bits (103), Expect = 2e-06 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 R Y ++PF GPR C+G ++ M++ KV L T+LR FR Sbjct: 437 RPAYVYMPFGEGPRICIGLRFGMMQTKVGLITLLRQFR 474 >AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CYP4G16 protein. Length = 151 Score = 44.8 bits (101), Expect = 3e-06 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVG 634 + A RHYYAFVPF+AGPR+C+G Sbjct: 129 KQANRHYYAFVPFTAGPRNCIG 150 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 44.4 bits (100), Expect = 4e-06 Identities = 17/44 (38%), Positives = 29/44 (65%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 Y F+PF GPR C+G ++ M+++KV L +++R FR + + D Sbjct: 442 YTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVRAFRFLPTAQTPD 485 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 44.0 bits (99), Expect = 5e-06 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILR 583 RS RH +A+ PFS G R C+G +YA+ +K++L +LR Sbjct: 66 RSQGRHPHAYAPFSMGSRDCIGKRYAIQGMKLVLVHLLR 104 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 44.0 bits (99), Expect = 5e-06 Identities = 15/42 (35%), Positives = 29/42 (69%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + A RH + ++PF GPR C+G ++ M++ ++ L +L++FR Sbjct: 426 QEAKRHPFVYLPFGEGPRICIGLRFGMMQARIGLVYLLKHFR 467 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 43.6 bits (98), Expect = 6e-06 Identities = 17/44 (38%), Positives = 29/44 (65%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVI 568 + + RH YA+ PF GPR CVG ++ +L+ ++ L +L +FR + Sbjct: 365 QESKRHPYAWTPFGEGPRICVGPRFGLLQARIGLIYLLTSFRFV 408 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 43.6 bits (98), Expect = 6e-06 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR-VISDLKESDFKLQADIILKRA 511 RH +AF+PF GPR+C+G ++ +L++K + ++ R +S+ + ++ + A Sbjct: 435 RHTHAFLPFGDGPRNCIGMRFGLLEVKFGIVQMVSKLRFTVSERMQMPLRMSKTASILEA 494 Query: 510 EG 505 EG Sbjct: 495 EG 496 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 43.2 bits (97), Expect = 8e-06 Identities = 16/33 (48%), Positives = 26/33 (78%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRN 580 +A +PFSAG R+CVG +YA + +K++L +LR+ Sbjct: 127 FALLPFSAGSRNCVGLRYAWISMKIMLLKVLRS 159 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 42.3 bits (95), Expect = 1e-05 Identities = 15/39 (38%), Positives = 27/39 (69%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNF 577 A RH +A+ PF GPR C+G ++ M++ ++ L+ +L+ F Sbjct: 426 AKRHPFAWTPFGEGPRVCIGLRFGMMQARIGLAYLLQGF 464 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 42.3 bits (95), Expect = 1e-05 Identities = 16/55 (29%), Positives = 35/55 (63%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADII 523 ++ ++++PF GPR C+G ++ +L+ ++ L+ +LRN+ D ++ L+ D I Sbjct: 427 KNNFSYLPFGEGPRICIGMRFGLLQTRLGLAMLLRNYHFTIDPSDAARPLRIDPI 481 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 42.3 bits (95), Expect = 1e-05 Identities = 23/68 (33%), Positives = 42/68 (61%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A++PF GPR+C+ ++A++++K I+ IL N+ +LK S+ + + +K A+GF Sbjct: 464 AYLPFGIGPRNCIASRFALMEVKAIVYHILLNY----ELKRSE---RTSVPVKLAKGFS- 515 Query: 495 RLQPRKRM 472 L+P M Sbjct: 516 PLKPENGM 523 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 41.5 bits (93), Expect = 2e-05 Identities = 13/38 (34%), Positives = 28/38 (73%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H + F+PF G RSC+G + AM++++++++ ++R + V Sbjct: 455 HPFIFLPFGFGARSCIGKRLAMMEMEIVIARLVRRYEV 492 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 41.5 bits (93), Expect = 2e-05 Identities = 13/22 (59%), Positives = 20/22 (90%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVG 634 R+ RHYY+++PF+AGPR+C+G Sbjct: 129 RTQNRHYYSYIPFTAGPRNCIG 150 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 40.7 bits (91), Expect = 4e-05 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNF 577 R Y+F+PF GPR C+ ++ ML+ +V L+ +L +F Sbjct: 429 RKPYSFIPFGEGPRICIAARFGMLEARVGLAVLLMHF 465 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 40.3 bits (90), Expect = 6e-05 Identities = 16/54 (29%), Positives = 33/54 (61%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADII 523 H Y +PF G R+C+G ++A +L+++LS + R ++V + ++ +K+ I Sbjct: 44 HPYVSLPFGYGRRTCIGRRFAECELQILLSKLFRRYQVEYNYEKLTYKVNPTYI 97 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 40.3 bits (90), Expect = 6e-05 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKV 604 RH Y F+PF GPR C+G ++ M++ KV Sbjct: 62 RHPYVFLPFGEGPRICIGLRFGMMQTKV 89 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 40.3 bits (90), Expect = 6e-05 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL-QADIILKRAEGF 502 Y F+PF AGP+ C+G + L+L+ +L+ +L ++ + K + L A ++K Sbjct: 427 YTFLPFGAGPKICIGYRQGKLQLRTMLAVLLSSYEFATCAKSTPGALSNAHTVIKPQGDL 486 Query: 501 QVRLQPRKRMAKA 463 ++++ R+ A Sbjct: 487 WLKVKKLNRVVAA 499 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 40.3 bits (90), Expect = 6e-05 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQ---ADII 523 A R Y ++PF GPR C+G ++ ++ K+ L+++L FR S + +Q + I Sbjct: 430 ARRDPYCYLPFGEGPRVCIGMRFGSIQAKLGLASLLDRFR-FSACDRTQIPVQYSRTNFI 488 Query: 522 LKRAEGFQVRLQ 487 L A G +R++ Sbjct: 489 LGPANGVWLRVE 500 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 39.9 bits (89), Expect = 8e-05 Identities = 18/52 (34%), Positives = 33/52 (63%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADII 523 + F+PF G RSC+G + AM++++VIL+ +R F + + D+K + +I Sbjct: 450 FIFLPFGFGSRSCIGKRLAMMEMEVILARWIRQFEFRWNYE--DYKFRTTVI 499 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 39.5 bits (88), Expect = 1e-04 Identities = 16/46 (34%), Positives = 30/46 (65%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFK 541 + F+PF G RSC+G + AM++L++I + ++R F + + + FK Sbjct: 457 FIFLPFGFGARSCIGRRLAMMELEMITARLVRQFELRWNYDKLHFK 502 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 38.3 bits (85), Expect = 2e-04 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDL 559 F+PF GPR C+G + ++ +KV L ++R+FR D+ Sbjct: 221 FMPFGLGPRHCIGDTFGLMLVKVGLVAMVRSFRFTLDV 258 >AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 38.3 bits (85), Expect = 2e-04 Identities = 13/38 (34%), Positives = 29/38 (76%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +P+ G R C+G ++A L+++++L+ +LR+F++ Sbjct: 66 HPFASLPYGYGARMCLGRRFADLEMQILLAKLLRSFKL 103 >AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 37.9 bits (84), Expect = 3e-04 Identities = 24/60 (40%), Positives = 33/60 (55%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R A +PF+ G RSC+G K A L++ +LS IL F + L E+D + ILK Sbjct: 16 STGRTPSASLPFAIGARSCIGQKIAQLQMHYLLSMILTKFEL--TLAEADQQDAIKPILK 73 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 37.9 bits (84), Expect = 3e-04 Identities = 12/38 (31%), Positives = 27/38 (71%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H + ++PF G RSC+G + AM+++++++ ++R + V Sbjct: 454 HPFVYLPFGFGARSCIGKRLAMMEMEILVCRMVRKYDV 491 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 37.9 bits (84), Expect = 3e-04 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A+ PF AGPR+C+G + +L K+ L +L F + + I L G + Sbjct: 427 AYYPFGAGPRNCIGLRQGLLLSKIALVMMLSRFNFSATIPRKIKFEPVSITLAPKGGLPM 486 Query: 495 RLQPR 481 R++ R Sbjct: 487 RIENR 491 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 37.5 bits (83), Expect = 4e-04 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILR--NFRVISDLKESDFKLQADIILKRAEGF 502 A+ PF AGPR+C+G + + K+ L +L NF+ + K F + A +++ +GF Sbjct: 427 AYYPFGAGPRNCIGLRQGVFVSKIGLVLLLSKYNFQATTPAKVK-FAV-ATVVVTPEDGF 484 Query: 501 QVRLQPR 481 +R++ R Sbjct: 485 PMRVEHR 491 >AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CYP4C26 protein. Length = 154 Score = 37.1 bits (82), Expect = 5e-04 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVG 634 RH YA++PF+AGPR+C+G Sbjct: 132 RHPYAYIPFTAGPRNCIG 149 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 37.1 bits (82), Expect = 5e-04 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVG 634 S RH Y+++PF+AGPR+C+G Sbjct: 129 STNRHPYSYIPFTAGPRNCIG 149 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 37.1 bits (82), Expect = 5e-04 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVG 634 RH YA++PF+AGPR+C+G Sbjct: 132 RHPYAYIPFTAGPRNCIG 149 >AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 protein. Length = 83 Score = 34.7 bits (76), Expect = 0.003 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 F+PF GPR C+G ++A++++K L ++ + V Sbjct: 28 FLPFGDGPRQCLGMRFALMQVKRGLFEVITKYEV 61 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 34.7 bits (76), Expect = 0.003 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVG 634 R YA++PFSAGPR+C+G Sbjct: 135 RSPYAYIPFSAGPRNCIG 152 >AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CYP4C25 protein. Length = 149 Score = 33.9 bits (74), Expect = 0.005 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVG 634 R+ YA +PFSAGPR+C+G Sbjct: 132 RNPYAXIPFSAGPRNCIG 149 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 33.9 bits (74), Expect = 0.005 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A+ PF AGPR+C+G + K+ ++ NF+ + K A + L GF + Sbjct: 427 AYYPFGAGPRNCIGQGVLVSKIGLVFLLSKFNFQATTPAKVK--FAAATVGLTPDAGFPM 484 Query: 495 RLQPRK 478 R+ RK Sbjct: 485 RIDHRK 490 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 33.9 bits (74), Expect = 0.005 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNF 577 A + F GPR+C+G ++A+++ K + +L +F Sbjct: 464 AMLAFGLGPRNCIGSRFALMETKAVFFFLLTHF 496 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 33.5 bits (73), Expect = 0.007 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLK 607 AF+PF+ G R+C+G +YAM +K Sbjct: 282 AFMPFNTGSRNCIGSRYAMQIMK 304 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 33.5 bits (73), Expect = 0.007 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 678 YAFVPFSAGPRSCVG 634 YA+VPF+AGPR+C+G Sbjct: 136 YAYVPFTAGPRNCIG 150 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 33.5 bits (73), Expect = 0.007 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVG 634 S R Y+++PF+AGPR+C+G Sbjct: 130 SEKRQPYSYIPFTAGPRNCIG 150 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 32.7 bits (71), Expect = 0.011 Identities = 13/23 (56%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 699 RSAXR-HYYAFVPFSAGPRSCVG 634 RSA + + Y ++PFSAGPR+C+G Sbjct: 128 RSAEKTNPYQYIPFSAGPRNCIG 150 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 32.7 bits (71), Expect = 0.011 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 678 YAFVPFSAGPRSCVG 634 Y +VPFSAGPR+C+G Sbjct: 136 YQYVPFSAGPRNCIG 150 >AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 31.9 bits (69), Expect = 0.020 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNF 577 A+ PF GPR+C+G + ++ K+ L +L F Sbjct: 45 AYYPFGLGPRNCIGLRQGIMLSKIGLVLMLSRF 77 >AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CYP4H17 protein. Length = 151 Score = 31.9 bits (69), Expect = 0.020 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -2 Query: 678 YAFVPFSAGPRSCVG 634 Y ++PFSAGPR+C+G Sbjct: 136 YDYIPFSAGPRNCIG 150 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 31.9 bits (69), Expect = 0.020 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -2 Query: 678 YAFVPFSAGPRSCVG 634 Y ++PFSAGPR+C+G Sbjct: 136 YDYIPFSAGPRNCIG 150 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 31.5 bits (68), Expect = 0.026 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAM 619 ++PF AGPR+C+G ++A+ Sbjct: 88 YLPFGAGPRNCIGSRFAL 105 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 31.5 bits (68), Expect = 0.026 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 A R + PF GPR C+G ++A+ +++ + ++ F + Sbjct: 49 AYRERGVYFPFGDGPRMCLGMRFAVTQVRRAIVEVVERFSI 89 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 31.5 bits (68), Expect = 0.026 Identities = 12/23 (52%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 699 RSAXR-HYYAFVPFSAGPRSCVG 634 RSA + + Y ++PF+AGPR+C+G Sbjct: 128 RSAEKTNPYQYIPFTAGPRNCIG 150 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 30.7 bits (66), Expect = 0.046 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -2 Query: 678 YAFVPFSAGPRSCVG 634 Y ++PF+AGPR+C+G Sbjct: 136 YDYIPFTAGPRNCIG 150 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 669 VPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 VPF AG R C G +A + + L+ +++NF + Sbjct: 133 VPFGAGKRLCAGETFARNIMFLTLAALMQNFNI 165 >AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CYP4H14 protein. Length = 151 Score = 29.5 bits (63), Expect = 0.11 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -2 Query: 678 YAFVPFSAGPRSCVG 634 + ++PFSAGPR+C+G Sbjct: 136 FDYLPFSAGPRNCIG 150 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 28.7 bits (61), Expect = 0.19 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISD 562 F+PFS G R+C+G +I++ IL+ + V S+ Sbjct: 102 FLPFSIGKRTCIGQNLVRGFSFIIIANILQKYDVHSN 138 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 25.8 bits (54), Expect = 1.3 Identities = 8/33 (24%), Positives = 21/33 (63%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNF 577 +++ F GPR C+ ++ L+ + L+ +L+++ Sbjct: 430 SYLAFGDGPRMCIAMRFGKLQTCLGLAMLLKSY 462 >AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 protein. Length = 95 Score = 25.4 bits (53), Expect = 1.7 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 672 FVPFSAGPRSCVG 634 ++PF GPR+C+G Sbjct: 82 YLPFGIGPRNCIG 94 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 25.4 bits (53), Expect = 1.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKY 625 ++PF GPR+C+G + Sbjct: 82 YMPFGVGPRTCLGSHF 97 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 25.0 bits (52), Expect = 2.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 672 FVPFSAGPRSCVG 634 F+PF GPR C+G Sbjct: 73 FLPFGEGPRMCLG 85 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 666 PFSAGPRSCVGCKYAMLKLKVILSTILRNFRVI 568 PF G C+G A L + L+T L++F ++ Sbjct: 113 PFGVGKHRCMGELMAKSNLFLFLTTTLQSFDLL 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,897 Number of Sequences: 2352 Number of extensions: 9000 Number of successful extensions: 75 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -