BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A07 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC060857-1|AAH60857.1| 525|Homo sapiens cytochrome P450, family... 73 1e-12 AY422002-1|AAR31180.1| 525|Homo sapiens cytochrome P450 4V2 pro... 73 1e-12 AK126473-1|BAC86562.1| 503|Homo sapiens protein ( Homo sapiens ... 73 1e-12 AK122600-1|BAC85487.1| 525|Homo sapiens protein ( Homo sapiens ... 73 1e-12 AF133298-1|AAD49566.1| 520|Homo sapiens cytochrome P450 protein. 64 6e-10 BC035350-1|AAH35350.1| 524|Homo sapiens cytochrome P450, family... 60 7e-09 AY358977-1|AAQ89336.1| 524|Homo sapiens CYP4F12 protein. 60 7e-09 AY008841-1|AAG33247.1| 524|Homo sapiens cytochrome P450 isoform... 60 7e-09 AC004523-1|AAC11543.1| 458|Homo sapiens F22329_1 protein. 60 7e-09 AB035131-1|BAB18270.1| 524|Homo sapiens cytochrome P450 protein. 60 7e-09 AB035130-1|BAB18269.1| 524|Homo sapiens cytochrome P450 protein. 60 7e-09 X16699-1|CAA34672.1| 511|Homo sapiens protein ( Human mRNA for ... 59 2e-08 U02388-1|AAC50052.2| 520|Homo sapiens cytochrome P450 4F2 protein. 59 2e-08 J02871-1|AAA35712.1| 511|Homo sapiens protein ( Human lung cyto... 59 2e-08 D26480-1|BAA05490.1| 520|Homo sapiens leukotriene B4 omega-hydr... 59 2e-08 DQ518907-1|ABF47106.1| 511|Homo sapiens cytochrome P450, family... 59 2e-08 BC067440-1|AAH67440.1| 520|Homo sapiens cytochrome P450, family... 59 2e-08 BC067439-1|AAH67439.1| 520|Homo sapiens cytochrome P450, family... 59 2e-08 BC067437-1|AAH67437.1| 520|Homo sapiens cytochrome P450, family... 59 2e-08 BC017758-1|AAH17758.1| 512|Homo sapiens cytochrome P450, family... 59 2e-08 AY151049-1|AAN72312.1| 497|Homo sapiens pulmonary cytochrome P4... 59 2e-08 AY151048-1|AAN72311.1| 512|Homo sapiens pulmonary cytochrome P4... 59 2e-08 AY064486-1|AAL57721.1| 511|Homo sapiens cytochrome P450 protein. 59 2e-08 AY064485-1|AAL57720.1| 511|Homo sapiens cytochrome P450 protein. 59 2e-08 AL593856-7|CAI16982.1| 512|Homo sapiens cytochrome P450, family... 59 2e-08 AL593856-6|CAI16981.1| 511|Homo sapiens cytochrome P450, family... 59 2e-08 AL593856-5|CAI16983.1| 497|Homo sapiens cytochrome P450, family... 59 2e-08 AL356793-4|CAI22557.1| 512|Homo sapiens cytochrome P450, family... 59 2e-08 AL356793-3|CAI22559.1| 511|Homo sapiens cytochrome P450, family... 59 2e-08 AL356793-2|CAI22558.1| 497|Homo sapiens cytochrome P450, family... 59 2e-08 AF491285-1|AAM09532.1| 511|Homo sapiens cytochrome P450 protein. 59 2e-08 AF467894-1|AAL67578.1| 520|Homo sapiens cytochrome P450, subfam... 59 2e-08 AC005336-1|AAC27730.1| 520|Homo sapiens CYP4F2 protein. 59 2e-08 AB015306-1|BAA75823.1| 520|Homo sapiens Leukotriene B4 omega-hy... 59 2e-08 AY792513-1|AAV40834.1| 520|Homo sapiens cytochrome P450, family... 58 2e-08 AF054821-1|AAC08589.1| 520|Homo sapiens cytochrome P-450 protein. 58 2e-08 D12620-1|BAA02144.1| 520|Homo sapiens cytochrome P-450LTBV prot... 58 4e-08 AB002461-1|BAA25991.1| 520|Homo sapiens leukotriene B4 omega-hy... 58 4e-08 AB002454-1|BAA25990.1| 520|Homo sapiens leukotriene B4 omega-hy... 58 4e-08 BC028102-1|AAH28102.1| 509|Homo sapiens cytochrome P450, family... 56 9e-08 BC016853-1|AAH16853.1| 524|Homo sapiens CYP4F11 protein protein. 56 9e-08 AY358537-1|AAQ88901.1| 509|Homo sapiens EFSW1929 protein. 56 9e-08 AM040940-1|CAJ13826.1| 509|Homo sapiens cytochrome P450 protein. 56 9e-08 AL450996-1|CAH71035.1| 509|Homo sapiens cytochrome P450, family... 56 9e-08 AK131355-1|BAD18508.1| 508|Homo sapiens protein ( Homo sapiens ... 56 9e-08 AK098065-1|BAC05226.1| 509|Homo sapiens protein ( Homo sapiens ... 56 9e-08 AK091806-1|BAC03751.1| 444|Homo sapiens protein ( Homo sapiens ... 56 9e-08 AF236085-1|AAG15889.1| 524|Homo sapiens CYP4F11 protein. 56 2e-07 BC093896-1|AAH93896.1| 531|Homo sapiens cytochrome P450, family... 54 6e-07 BC093894-1|AAH93894.1| 531|Homo sapiens cytochrome P450, family... 54 6e-07 BC069351-1|AAH69351.1| 531|Homo sapiens cytochrome P450, family... 54 6e-07 AK096820-1|BAC04868.1| 531|Homo sapiens protein ( Homo sapiens ... 54 6e-07 AY280371-1|AAQ21367.1| 519|Homo sapiens cytochrome P450 4A22K p... 51 3e-06 S67580-1|AAB29502.1| 519|Homo sapiens fatty acid omega-hydroxyl... 50 6e-06 L04751-1|AAA58436.1| 519|Homo sapiens cytochrome P450 protein. 50 6e-06 D26481-1|BAA05491.1| 519|Homo sapiens fatty acids omega-hydroxy... 50 6e-06 AY369778-1|AAQ56847.1| 519|Homo sapiens cytochrome P450, family... 50 6e-06 AL731892-3|CAH72778.1| 519|Homo sapiens cytochrome P450, family... 50 6e-06 AF525488-1|AAO16078.1| 519|Homo sapiens cytochrome P450, subfam... 50 6e-06 AY280372-1|AAQ21368.1| 519|Homo sapiens cytochrome P450 4A22 pr... 50 8e-06 AL135960-10|CAI19736.1| 421|Homo sapiens cytochrome P450, famil... 50 8e-06 AL135960-9|CAI19737.1| 519|Homo sapiens cytochrome P450, family... 50 8e-06 AF208532-1|AAF76722.1| 519|Homo sapiens fatty acid omega-hydrox... 50 8e-06 AY358631-1|AAQ88994.1| 505|Homo sapiens EPSW3060 protein. 47 6e-05 AY262056-1|AAO89257.1| 505|Homo sapiens cytochrome P450 protein. 47 6e-05 AL450996-2|CAH71036.1| 505|Homo sapiens cytochrome P450, family... 47 6e-05 AL135960-6|CAI19734.1| 505|Homo sapiens cytochrome P450, family... 47 6e-05 J04813-1|AAA02993.1| 502|Homo sapiens cytochrome P450 PCN3 prot... 46 1e-04 BC033862-1|AAH33862.1| 502|Homo sapiens cytochrome P450, family... 46 1e-04 AK223008-1|BAD96728.1| 502|Homo sapiens cytochrome P450, family... 46 1e-04 AJ563379-2|CAD91649.1| 84|Homo sapiens cytochrome P450 protein. 46 1e-04 AJ563378-3|CAD91347.1| 173|Homo sapiens hypothetical protein pr... 46 1e-04 AJ563378-2|CAD91647.1| 160|Homo sapiens cytochrome P450 protein. 46 1e-04 AC005020-1|AAS02016.1| 502|Homo sapiens unknown protein. 46 1e-04 M14096-1|AAA35744.1| 503|Homo sapiens protein ( Human cytochrom... 46 2e-04 J04449-1|AAA35747.1| 502|Homo sapiens cytochrome P450 nifedipin... 46 2e-04 X12387-1|CAA30944.1| 503|Homo sapiens protein ( Human mRNA for ... 45 2e-04 M18907-1|AAA35745.1| 503|Homo sapiens protein ( Human P450 mRNA... 45 2e-04 M13785-1|AAA35742.1| 504|Homo sapiens protein ( Human liver glu... 45 2e-04 D13705-1|BAA02864.1| 521|Homo sapiens fatty acid omega-hydroxyl... 45 2e-04 D00003-1|BAA00001.1| 504|Homo sapiens cytochrome P-450 protein. 45 2e-04 DQ924960-1|ABI96208.1| 503|Homo sapiens cytochrome P450 family ... 45 2e-04 DQ005611-1|AAY16980.1| 503|Homo sapiens cytochrome P450, family... 45 2e-04 BC101631-1|AAI01632.1| 503|Homo sapiens cytochrome P450, subfam... 45 2e-04 BC100981-1|AAI00982.1| 393|Homo sapiens CYP3A43 protein protein. 45 2e-04 BC069418-1|AAH69418.1| 503|Homo sapiens cytochrome P450, family... 45 2e-04 AY390425-1|AAQ92353.1| 503|Homo sapiens cytochrome P450 CYP3A43... 45 2e-04 AY390424-1|AAQ92352.1| 503|Homo sapiens cytochrome P450 CYP3A43... 45 2e-04 AJ563377-1|CAD91345.1| 353|Homo sapiens cytochrome P450 protein. 45 2e-04 AJ563376-2|CAD91645.1| 430|Homo sapiens cytochrome P450 protein. 45 2e-04 AJ563375-1|CAD91343.1| 503|Homo sapiens cytochrome P450 protein. 45 2e-04 AF337813-1|AAK38841.1| 503|Homo sapiens cytochrome P450 subfami... 45 2e-04 AF319634-1|AAK00325.1| 503|Homo sapiens cytochrome P450 CYP3A43... 45 2e-04 AF280109-1|AAG33010.1| 504|Homo sapiens cytochrome P450 subfami... 45 2e-04 AF280108-1|AAG33009.1| 503|Homo sapiens cytochrome P450 subfami... 45 2e-04 AF280107-2|AAG32290.1| 503|Homo sapiens cytochrome P450 polypep... 45 2e-04 AF209389-1|AAF21034.1| 503|Homo sapiens cytochrome P450 IIIA4 p... 45 2e-04 AF182273-1|AAF13598.1| 503|Homo sapiens cytochrome P450-3A4 pro... 45 2e-04 AC011904-5|AAS07394.1| 504|Homo sapiens unknown protein. 45 2e-04 AC011904-4|AAS07395.1| 503|Homo sapiens unknown protein. 45 2e-04 S67581-1|AAB29503.1| 591|Homo sapiens fatty acid omega-hydroxyl... 45 3e-04 D00408-1|BAA00310.1| 503|Homo sapiens cytochrome P-450 HFLa pro... 44 4e-04 BC067436-1|AAH67436.1| 503|Homo sapiens cytochrome P450, family... 44 4e-04 AF315325-1|AAG48618.1| 535|Homo sapiens cytochrome P450 variant... 44 4e-04 AF280107-3|AAG32289.1| 503|Homo sapiens cytochrome P450 polypep... 44 4e-04 AC005336-2|AAC27731.1| 93|Homo sapiens F20191_1, partial CDS p... 44 5e-04 M29874-1|AAA52144.1| 491|Homo sapiens CYP2B protein. 42 0.002 DQ298753-1|ABB84469.1| 491|Homo sapiens cytochrome P450, family... 42 0.002 BC067431-1|AAH67431.1| 491|Homo sapiens cytochrome P450, family... 42 0.002 BC067430-1|AAH67430.1| 491|Homo sapiens cytochrome P450, family... 42 0.002 BC022539-1|AAH22539.1| 500|Homo sapiens cytochrome P450, family... 42 0.002 AK090886-1|BAC03539.1| 337|Homo sapiens protein ( Homo sapiens ... 42 0.002 AF182277-1|AAF13602.1| 491|Homo sapiens cytochrome P450-2B6 pro... 42 0.002 AF094480-1|AAD41244.1| 500|Homo sapiens cholesterol 24-hydroxyl... 42 0.002 AC023172-1|AAF32444.1| 491|Homo sapiens CYP2B6 protein. 42 0.002 Y07508-1|CAA68807.1| 503|Homo sapiens protein ( Human mRNA for ... 42 0.003 X13589-1|CAA31929.1| 503|Homo sapiens protein ( Human mRNA for ... 42 0.003 M80647-1|AAA60618.1| 534|Homo sapiens thromboxane synthase prot... 42 0.003 M61856-1|AAB59356.1| 490|Homo sapiens cytochrome protein. 42 0.003 M30804-1|AAA35728.1| 503|Homo sapiens protein ( Human aromatase... 42 0.003 M28420-1|AAA52141.1| 419|Homo sapiens cytochrome P-450 aromatas... 42 0.003 M22246-1|AAA35557.1| 503|Homo sapiens protein ( Human aromatase... 42 0.003 M18856-1|AAA35556.1| 419|Homo sapiens protein ( Human aromatase... 42 0.003 L16876-1|AAA02630.1| 490|Homo sapiens cytochrome P-4502C18 prot... 42 0.003 J04127-1|AAA52132.1| 503|Homo sapiens CYP19 protein. 42 0.003 DQ118405-1|AAZ23558.1| 503|Homo sapiens cytochrome P450 subfami... 42 0.003 BX538127-1|CAD98029.1| 310|Homo sapiens hypothetical protein pr... 42 0.003 BC107785-1|AAI07786.1| 503|Homo sapiens cytochrome P450, family... 42 0.003 BC096260-1|AAH96260.1| 431|Homo sapiens CYP2C18 protein protein. 42 0.003 BC096258-1|AAH96258.1| 490|Homo sapiens cytochrome P450, family... 42 0.003 BC096257-1|AAH96257.1| 490|Homo sapiens cytochrome P450, family... 42 0.003 BC069666-1|AAH69666.1| 490|Homo sapiens cytochrome P450, family... 42 0.003 BC041157-1|AAH41157.1| 534|Homo sapiens thromboxane A synthase ... 42 0.003 BC035959-1|AAH35959.1| 503|Homo sapiens cytochrome P450, family... 42 0.003 BC014117-1|AAH14117.1| 466|Homo sapiens TBXAS1 protein protein. 42 0.003 AY957953-1|AAX44046.1| 503|Homo sapiens cytochrome P450, family... 42 0.003 AL583836-1|CAH74067.1| 490|Homo sapiens cytochrome P450, family... 42 0.003 AK223466-1|BAD97186.1| 534|Homo sapiens thromboxane A synthase ... 42 0.003 AF233625-1|AAF99279.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233624-1|AAF99278.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233623-1|AAF99277.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233622-1|AAF99276.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233621-1|AAF99275.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233620-1|AAF99274.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233619-1|AAF99273.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233618-1|AAF99272.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233617-1|AAF99271.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233616-1|AAF99270.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AF233615-1|AAF99269.1| 534|Homo sapiens thromboxane synthase pr... 42 0.003 AK223510-1|BAD97230.1| 490|Homo sapiens cytochrome P450, family... 41 0.004 Y00498-1|CAA68550.1| 490|Homo sapiens IIC2 protein. 40 0.006 X51535-1|CAA35915.1| 210|Homo sapiens cytochrome P-450 HPH (120... 40 0.006 X13930-1|CAA32118.1| 494|Homo sapiens protein ( Human CYP2A4 mR... 40 0.006 X13929-1|CAA32117.1| 448|Homo sapiens P-450 IIA3 protein (1 is ... 40 0.006 X13897-1|CAA32097.1| 489|Homo sapiens protein ( Human mRNA for ... 40 0.006 M33318-1|AAA52067.1| 494|Homo sapiens CYP2A protein. 40 0.006 M21942-1|AAA52161.1| 462|Homo sapiens CYP2C protein. 40 0.006 M21941-1|AAA52160.1| 480|Homo sapiens CYP2C protein. 40 0.006 M17397-1|AAA35739.1| 490|Homo sapiens protein ( Human cytochrom... 40 0.006 D34625-1|BAA07011.1| 533|Homo sapiens thromboxane synthase prot... 40 0.006 BC096256-1|AAH96256.1| 494|Homo sapiens cytochrome P450, family... 40 0.006 BC096255-1|AAH96255.1| 494|Homo sapiens cytochrome P450, family... 40 0.006 BC096254-1|AAH96254.1| 494|Homo sapiens cytochrome P450, family... 40 0.006 BC096253-1|AAH96253.3| 494|Homo sapiens cytochrome P450, family... 40 0.006 BC020596-1|AAH20596.1| 490|Homo sapiens cytochrome P450, family... 40 0.006 AY514490-1|AAR89907.1| 490|Homo sapiens cytochrome P450, family... 40 0.006 AL359672-5|CAH71307.1| 490|Homo sapiens cytochrome P450, family... 40 0.006 AF182275-1|AAF13600.1| 494|Homo sapiens cytochrome P450-2A6 pro... 40 0.006 X59812-1|CAA42481.1| 530|Homo sapiens Vitamin D3 25-hydroxylase... 40 0.009 M62401-1|AAA52142.1| 531|Homo sapiens sterol 27-hydroxylase pro... 40 0.009 BC051851-1|AAH51851.1| 531|Homo sapiens cytochrome P450, family... 40 0.009 BC040430-1|AAH40430.1| 531|Homo sapiens cytochrome P450, family... 40 0.009 AY178622-1|AAO21126.1| 531|Homo sapiens steroid hydroxylase pro... 40 0.009 M33317-1|AAA52138.1| 494|Homo sapiens CYP2A protein. 40 0.011 X58906-1|CAA41709.1| 495|Homo sapiens steroid 21-monooxygenase ... 39 0.015 BC117165-1|AAI17166.1| 494|Homo sapiens cytochrome P450, family... 39 0.015 U22028-1|AAB40519.1| 494|Homo sapiens cytochrome P450 protein. 38 0.026 AY513609-1|AAR90940.1| 494|Homo sapiens cytochrome P450 2A13 va... 38 0.026 AY513608-1|AAR90939.1| 494|Homo sapiens cytochrome P450 2A13 va... 38 0.026 AY513606-1|AAR90937.1| 494|Homo sapiens cytochrome P450 2A13 va... 38 0.026 AY513605-1|AAR90936.1| 494|Homo sapiens cytochrome P450 2A13 va... 38 0.026 AY513604-1|AAR90935.1| 494|Homo sapiens cytochrome P450 2A13 va... 38 0.026 AF209774-1|AAG35775.1| 494|Homo sapiens cytochrome P450 2A13 pr... 38 0.026 X65962-1|CAA46778.1| 356|Homo sapiens cytochrome P-450 II C pro... 38 0.034 U51692-1|AAC50951.1| 503|Homo sapiens lanosterol 14-alpha demet... 38 0.034 U23942-1|AAB39951.1| 509|Homo sapiens lanosterol 14-demethylase... 38 0.034 S46963-1|AAB23864.2| 477|Homo sapiens cytochrome P-450 protein. 38 0.034 M61858-1|AAA52145.1| 370|Homo sapiens CYP2C17 protein. 38 0.034 M61854-1|AAB59426.1| 490|Homo sapiens cytochrome protein. 38 0.034 M21940-1|AAA52159.1| 383|Homo sapiens CYP2C protein. 38 0.034 M21939-1|AAA52158.1| 485|Homo sapiens CYP2C protein. 38 0.034 M15331-1|AAA52157.1| 485|Homo sapiens CYP2C protein. 38 0.034 L39102-1|AAL31348.1| 217|Homo sapiens S-mephenytoin 4-hydroxyla... 38 0.034 L16883-1|AAD13467.1| 169|Homo sapiens cytochrome P-450 2C protein. 38 0.034 L07093-1|AAA36660.1| 468|Homo sapiens cytochrome P450 protein. 38 0.034 D55653-1|BAA09512.1| 509|Homo sapiens lanosterol 14-demethylase... 38 0.034 D00173-1|BAA00123.1| 487|Homo sapiens cytochrome P-450 protein. 38 0.034 BC125054-1|AAI25055.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 BC032322-1|AAH32322.1| 509|Homo sapiens cytochrome P450, family... 38 0.034 AY796203-1|AAV41877.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 AY702706-1|AAT94065.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 AY341248-1|AAP88931.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 AY288916-1|AAP31972.1| 508|Homo sapiens cytochrome P450, family... 38 0.034 AL583836-2|CAH74068.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 AL359672-1|CAH71303.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 AL133513-2|CAH73444.1| 490|Homo sapiens cytochrome P450, family... 38 0.034 AF256213-1|AAG00416.1| 508|Homo sapiens 25- hydroxyvitamin D-1-... 38 0.034 AF246895-1|AAF64299.1| 508|Homo sapiens 25-hydroxyvitamin D-1-a... 38 0.034 AF027152-1|AAC51854.1| 508|Homo sapiens P450 25-hydroxyvitamin ... 38 0.034 AF020192-1|AAC51853.1| 508|Homo sapiens 25-hydroxyvitamin D-1-a... 38 0.034 AC000120-2|AAB46356.1| 509|Homo sapiens unknown protein. 38 0.034 AB006987-1|BAA23418.1| 508|Homo sapiens 25-hydroxyvitamin D3 1-... 38 0.034 AB005990-1|BAA22657.1| 508|Homo sapiens 25-hydroxyvitamin D3 1a... 38 0.034 AB005989-1|BAA22656.1| 508|Homo sapiens 25-hydroxyvitamin D3 1a... 38 0.034 AB005038-1|BAA23416.1| 508|Homo sapiens 25-hydroxyvitamin D3 1-... 38 0.034 M28548-1|AAA52065.1| 495|Homo sapiens protein ( Human mutant 21... 38 0.046 M26856-1|AAA52064.1| 495|Homo sapiens protein ( Human 21-hydrox... 38 0.046 M21550-1|AAA52063.1| 495|Homo sapiens CYP21 protein. 38 0.046 M17252-1|AAA59985.1| 230|Homo sapiens CYP21 protein. 38 0.046 M13936-1|AAA59695.1| 494|Homo sapiens CYP21P protein. 38 0.046 K03192-1|AAA52147.1| 331|Homo sapiens CYP1A1 protein. 38 0.046 BX679671-8|CAM26070.1| 494|Homo sapiens cytochrome P450, family... 38 0.046 BX679671-7|CAM26071.1| 464|Homo sapiens cytochrome P450, family... 38 0.046 BC128535-1|AAI28536.1| 143|Homo sapiens CYP21A2 protein protein. 38 0.046 BC125182-1|AAI25183.1| 494|Homo sapiens cytochrome P450, family... 38 0.046 BC125181-1|AAI25182.1| 495|Homo sapiens cytochrome P450, family... 38 0.046 AM183951-1|CAJ75805.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM183950-1|CAJ75804.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM183949-1|CAJ75803.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM183948-1|CAJ75802.1| 494|Homo sapiens steroid 21-hydroxylase ... 38 0.046 AM183947-1|CAJ75801.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM183946-1|CAJ75800.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM183945-1|CAJ75799.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM086565-1|CAJ31104.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AM086564-1|CAJ31103.1| 494|Homo sapiens steroid 21-hydroxylase,... 38 0.046 AL929593-2|CAI41778.1| 465|Homo sapiens cytochrome P450, family... 38 0.046 AL929593-1|CAI41779.1| 495|Homo sapiens cytochrome P450, family... 38 0.046 AL662849-19|CAI17480.1| 465|Homo sapiens cytochrome P450, famil... 38 0.046 AL662849-18|CAI17479.1| 495|Homo sapiens cytochrome P450, famil... 38 0.046 AL645922-24|CAI41754.1| 495|Homo sapiens cytochrome P450, famil... 38 0.046 AL645922-23|CAI41755.1| 465|Homo sapiens cytochrome P450, famil... 38 0.046 AL049547-7|CAB89301.1| 495|Homo sapiens dJ34F7.3 (cytochrome P4... 38 0.046 AK054616-1|BAB70774.1| 465|Homo sapiens protein ( Homo sapiens ... 38 0.046 AF077974-1|AAD45405.1| 403|Homo sapiens cytochrome P450 21-hydr... 38 0.046 AF019413-2|AAB67982.1| 495|Homo sapiens cytochrome P450 21-hydr... 38 0.046 U22029-1|AAB40520.1| 494|Homo sapiens cytochrome P450 protein. 37 0.060 U22027-1|AAB40518.1| 494|Homo sapiens cytochrome P450 protein. 37 0.060 X55764-1|CAA39290.1| 503|Homo sapiens protein ( Human mRNA for ... 36 0.11 X54741-1|CAA38539.1| 503|Homo sapiens aldosterone synthase (P-... 36 0.11 M32879-1|AAA52149.1| 503|Homo sapiens CYP11B1 protein. 36 0.11 D13752-1|BAA02899.1| 503|Homo sapiens steroid 18-hydroxylase pr... 36 0.11 BC096287-1|AAH96287.1| 503|Homo sapiens cytochrome P450, family... 36 0.11 BC096285-1|AAH96285.1| 574|Homo sapiens CYP11B1 protein protein. 36 0.11 BC033691-1|AAH33691.1| 504|Homo sapiens cytochrome P450, family... 36 0.11 AY358603-1|AAQ88966.1| 504|Homo sapiens Cytochrome p450 protein. 36 0.11 AF478474-1|AAL84813.1| 503|Homo sapiens mutated cytochrome P-45... 36 0.11 AF335278-1|AAK13498.1| 504|Homo sapiens cytochrome P450 2S1 pro... 36 0.11 BC025761-1|AAH25761.2| 490|Homo sapiens cytochrome P450, family... 36 0.14 AF372573-1|AAL69652.1| 495|Homo sapiens cytochrome P450 2F1 pro... 36 0.14 EF122241-1|ABO41976.1| 491|Homo sapiens cytochrome P450 2F1 var... 36 0.18 AK127151-1|BAC86855.1| 146|Homo sapiens protein ( Homo sapiens ... 36 0.18 J02906-1|AAA52156.1| 491|Homo sapiens CYP2F1 protein. 35 0.24 X08006-1|CAA30807.1| 497|Homo sapiens cytochrome P450 db1 protein. 35 0.32 M63871-1|AAA59984.1| 508|Homo sapiens CYP17 protein. 35 0.32 M33388-1|AAA53500.1| 497|Homo sapiens cytochrome P450 IID6 prot... 35 0.32 M33189-1|AAA35737.1| 500|Homo sapiens protein ( Human debrisoqu... 35 0.32 M31153-1|AAA52140.1| 508|Homo sapiens CYP17 protein. 35 0.32 M24499-1|AAA36403.1| 373|Homo sapiens cytochrome P450db1 protein. 35 0.32 M20403-1|AAA52153.1| 497|Homo sapiens CYP2D protein. 35 0.32 M19489-1|AAA36405.1| 508|Homo sapiens CYP17 protein. 35 0.32 M14564-1|AAA52151.1| 508|Homo sapiens CYP17 protein. 35 0.32 DQ530598-1|ABF50972.1| 508|Homo sapiens cytochrome P450, family... 35 0.32 DQ282162-1|ABB77909.1| 500|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282160-1|ABB77908.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282159-1|ABB77907.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282158-1|ABB77906.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282157-1|ABB77905.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282156-1|ABB77904.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282155-1|ABB77903.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282154-1|ABB77902.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282153-1|ABB77901.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282152-1|ABB77900.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282151-1|ABB77899.1| 496|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282147-1|ABB77898.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282146-1|ABB77897.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282145-1|ABB77896.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ282144-1|ABB77895.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ211354-2|ABB01372.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ211353-2|ABB01371.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 DQ211353-1|ABB01370.1| 497|Homo sapiens cytochrome P450 2D6 pro... 35 0.32 CR456430-1|CAG30316.1| 446|Homo sapiens CYP2D6 protein. 35 0.32 BT020000-1|AAV38803.1| 508|Homo sapiens cytochrome P450, family... 35 0.32 BC126858-1|AAI26859.1| 497|Homo sapiens cytochrome P450, family... 35 0.32 BC106758-1|AAI06759.1| 497|Homo sapiens cytochrome P450, family... 35 0.32 BC106757-1|AAI06758.1| 446|Homo sapiens cytochrome P450, family... 35 0.32 BC075024-1|AAH75024.1| 497|Homo sapiens cytochrome P450, family... 35 0.32 BC075023-1|AAH75023.1| 497|Homo sapiens cytochrome P450, family... 35 0.32 BC067432-1|AAH67432.1| 497|Homo sapiens cytochrome P450, family... 35 0.32 BC066877-1|AAH66877.1| 446|Homo sapiens CYP2D6 protein protein. 35 0.32 BC063388-1|AAH63388.1| 508|Homo sapiens cytochrome P450, family... 35 0.32 BC062997-1|AAH62997.1| 508|Homo sapiens cytochrome P450, family... 35 0.32 AY545216-1|AAS55001.1| 497|Homo sapiens cytochrome P4502D6 prot... 35 0.32 AY220845-1|AAO49806.1| 516|Homo sapiens cytochrome P450 protein. 35 0.32 AL358790-3|CAI52498.1| 508|Homo sapiens cytochrome P450, family... 35 0.32 AL358613-3|CAH72804.1| 428|Homo sapiens cytochrome P450, family... 35 0.32 AL358613-2|CAH72803.1| 497|Homo sapiens cytochrome P450, family... 35 0.32 AF005418-1|AAB88881.1| 497|Homo sapiens retinoic acid hydroxyla... 35 0.32 AB209492-1|BAD92729.1| 566|Homo sapiens Debrisoquine 4-hydroxyl... 35 0.32 M32881-1|AAA35741.1| 503|Homo sapiens protein ( Human steroid 1... 34 0.42 BC041839-1|AAH41839.1| 51|Homo sapiens CYP4V2 protein protein. 34 0.42 M12792-1|AAB59440.1| 494|Homo sapiens steroid 21-hydroxylase pr... 34 0.56 AK027605-1|BAB55227.1| 564|Homo sapiens protein ( Homo sapiens ... 34 0.56 BC039307-1|AAH39307.1| 372|Homo sapiens cytochrome P450, family... 33 0.74 AK131190-1|BAD18388.1| 372|Homo sapiens .-.-). protein. 33 0.74 X05367-1|CAA28965.1| 521|Homo sapiens desmolase protein. 32 1.7 U37143-1|AAC50370.2| 502|Homo sapiens cytochrome P450 monooxyge... 32 1.7 S67623-1|AAB29308.1| 257|Homo sapiens 25-hydroxyvitamin D 24-hy... 32 1.7 M28253-1|AAA36404.1| 239|Homo sapiens cytochrome P-450-scc prot... 32 1.7 M14565-1|AAA52162.1| 521|Homo sapiens CYP11A protein. 32 1.7 L13286-1|AAA62379.1| 513|Homo sapiens 1,25-dihydroxyvitamin D3 ... 32 1.7 BC032594-1|AAH32594.1| 502|Homo sapiens cytochrome P450, family... 32 1.7 BC032329-1|AAH32329.1| 521|Homo sapiens cytochrome P450, family... 32 1.7 AY858838-1|AAW50795.1| 372|Homo sapiens vitamin D 24-hydroxylas... 32 1.7 AY426985-1|AAQ93356.1| 502|Homo sapiens cytochrome P450, family... 32 1.7 AL138805-2|CAB91829.1| 514|Homo sapiens cytochrome P450, family... 32 1.7 AL138805-1|CAM27342.1| 372|Homo sapiens cytochrome P450, family... 32 1.7 AF272142-1|AAM44456.1| 502|Homo sapiens cytochrome P450 protein. 32 1.7 AB080265-1|BAB85489.1| 502|Homo sapiens cytochrome P450 2J2 pro... 32 1.7 J02843-1|AAA52155.1| 493|Homo sapiens protein ( Human cytochrom... 31 3.0 J02625-1|AAA35743.1| 493|Homo sapiens protein ( Human cytochrom... 31 3.0 DQ515958-1|ABF47105.1| 493|Homo sapiens cytochrome P450, family... 31 3.0 DQ149222-1|AAZ77710.1| 493|Homo sapiens cytochrome P450 2E1 pro... 31 3.0 BC067433-1|AAH67433.1| 493|Homo sapiens cytochrome P450, family... 31 3.0 AL161645-2|CAH70047.1| 493|Homo sapiens cytochrome P450, family... 31 3.0 AF182276-1|AAF13601.1| 493|Homo sapiens cytochrome P450-2E1 pro... 31 3.0 AF084225-1|AAD13753.1| 462|Homo sapiens cytochrome P450 2E1 pro... 31 3.0 BC067435-1|AAH67435.1| 493|Homo sapiens cytochrome P450, family... 30 6.9 S77873-1|AAD14267.1| 68|Homo sapiens CYP2E1 protein. 30 9.1 AL358613-1|CAH72802.2| 522|Homo sapiens cytochrome P450, family... 30 9.1 AK127234-1|BAC86895.1| 130|Homo sapiens ). protein. 30 9.1 >BC060857-1|AAH60857.1| 525|Homo sapiens cytochrome P450, family 4, subfamily V, polypeptide 2 protein. Length = 525 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/69 (46%), Positives = 50/69 (72%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAE 508 RH YA+VPFSAGPR+C+G K+A+++ K ILS ILR+F + S+ K + L+ +IL+ + Sbjct: 452 RHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSN 511 Query: 507 GFQVRLQPR 481 G ++L+ R Sbjct: 512 GIWIKLKRR 520 >AY422002-1|AAR31180.1| 525|Homo sapiens cytochrome P450 4V2 protein. Length = 525 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/69 (46%), Positives = 50/69 (72%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAE 508 RH YA+VPFSAGPR+C+G K+A+++ K ILS ILR+F + S+ K + L+ +IL+ + Sbjct: 452 RHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSN 511 Query: 507 GFQVRLQPR 481 G ++L+ R Sbjct: 512 GIWIKLKRR 520 >AK126473-1|BAC86562.1| 503|Homo sapiens protein ( Homo sapiens cDNA FLJ44509 fis, clone UTERU3001585, weakly similar to Cytochrome P450 4c3 (EC 1.14.-.-). ). Length = 503 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/69 (46%), Positives = 50/69 (72%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAE 508 RH YA+VPFSAGPR+C+G K+A+++ K ILS ILR+F + S+ K + L+ +IL+ + Sbjct: 430 RHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSN 489 Query: 507 GFQVRLQPR 481 G ++L+ R Sbjct: 490 GIWIKLKRR 498 >AK122600-1|BAC85487.1| 525|Homo sapiens protein ( Homo sapiens cDNA FLJ16007 fis, clone KIDNE2006580, weakly similar to CYTOCHROME P450 4C1 (EC 1.14.14.1). ). Length = 525 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/69 (46%), Positives = 50/69 (72%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAE 508 RH YA+VPFSAGPR+C+G K+A+++ K ILS ILR+F + S+ K + L+ +IL+ + Sbjct: 452 RHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSN 511 Query: 507 GFQVRLQPR 481 G ++L+ R Sbjct: 512 GIWIKLKRR 520 >AF133298-1|AAD49566.1| 520|Homo sapiens cytochrome P450 protein. Length = 520 Score = 63.7 bits (148), Expect = 6e-10 Identities = 27/64 (42%), Positives = 46/64 (71%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G K+AM ++KV+L+ L FR++ D +E + +I+L+ +G + Sbjct: 457 AFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREP--RRTPEIVLRAEDGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >BC035350-1|AAH35350.1| 524|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 12 protein. Length = 524 Score = 60.1 bits (139), Expect = 7e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R AF+PFSAGPR+C+G +AM ++KV+L+ +L +FR + D E KL ++I++ Sbjct: 450 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKL--ELIMR 507 Query: 516 RAEGFQVRLQP 484 G +R++P Sbjct: 508 AEGGLWLRVEP 518 >AY358977-1|AAQ89336.1| 524|Homo sapiens CYP4F12 protein. Length = 524 Score = 60.1 bits (139), Expect = 7e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R AF+PFSAGPR+C+G +AM ++KV+L+ +L +FR + D E KL ++I++ Sbjct: 450 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKL--ELIMR 507 Query: 516 RAEGFQVRLQP 484 G +R++P Sbjct: 508 AEGGLWLRVEP 518 >AY008841-1|AAG33247.1| 524|Homo sapiens cytochrome P450 isoform 4F12 protein. Length = 524 Score = 60.1 bits (139), Expect = 7e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R AF+PFSAGPR+C+G +AM ++KV+L+ +L +FR + D E KL ++I++ Sbjct: 450 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKL--ELIMR 507 Query: 516 RAEGFQVRLQP 484 G +R++P Sbjct: 508 AEGGLWLRVEP 518 >AC004523-1|AAC11543.1| 458|Homo sapiens F22329_1 protein. Length = 458 Score = 60.1 bits (139), Expect = 7e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R AF+PFSAGPR+C+G +AM ++KV+L+ +L +FR + D E KL ++I++ Sbjct: 384 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKL--ELIMR 441 Query: 516 RAEGFQVRLQP 484 G +R++P Sbjct: 442 AEGGLWLRVEP 452 >AB035131-1|BAB18270.1| 524|Homo sapiens cytochrome P450 protein. Length = 524 Score = 60.1 bits (139), Expect = 7e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R AF+PFSAGPR+C+G +AM ++KV+L+ +L +FR + D E KL ++I++ Sbjct: 450 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKL--ELIMR 507 Query: 516 RAEGFQVRLQP 484 G +R++P Sbjct: 508 AEGGLWLRVEP 518 >AB035130-1|BAB18269.1| 524|Homo sapiens cytochrome P450 protein. Length = 524 Score = 60.1 bits (139), Expect = 7e-09 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S R AF+PFSAGPR+C+G +AM ++KV+L+ +L +FR + D E KL ++I++ Sbjct: 450 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKL--ELIMR 507 Query: 516 RAEGFQVRLQP 484 G +R++P Sbjct: 508 AEGGLWLRVEP 518 >X16699-1|CAA34672.1| 511|Homo sapiens protein ( Human mRNA for cytochrome P-450HP. ). Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >U02388-1|AAC50052.2| 520|Homo sapiens cytochrome P450 4F2 protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >J02871-1|AAA35712.1| 511|Homo sapiens protein ( Human lung cytochrome P450 (IV subfamily) BI protein, complete cds. ). Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >D26480-1|BAA05490.1| 520|Homo sapiens leukotriene B4 omega-hydroxylase protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >DQ518907-1|ABF47106.1| 511|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >BC067440-1|AAH67440.1| 520|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 2 protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >BC067439-1|AAH67439.1| 520|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 2 protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >BC067437-1|AAH67437.1| 520|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 2 protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >BC017758-1|AAH17758.1| 512|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 512 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 436 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 494 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 495 SKNGFHLHLKP 505 >AY151049-1|AAN72312.1| 497|Homo sapiens pulmonary cytochrome P450 4B1 variant protein. Length = 497 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 421 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 479 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 480 SKNGFHLHLKP 490 >AY151048-1|AAN72311.1| 512|Homo sapiens pulmonary cytochrome P450 4B1 protein. Length = 512 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 436 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 494 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 495 SKNGFHLHLKP 505 >AY064486-1|AAL57721.1| 511|Homo sapiens cytochrome P450 protein. Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >AY064485-1|AAL57720.1| 511|Homo sapiens cytochrome P450 protein. Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >AL593856-7|CAI16982.1| 512|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 512 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 436 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 494 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 495 SKNGFHLHLKP 505 >AL593856-6|CAI16981.1| 511|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >AL593856-5|CAI16983.1| 497|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 497 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 421 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 479 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 480 SKNGFHLHLKP 490 >AL356793-4|CAI22557.1| 512|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 512 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 436 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 494 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 495 SKNGFHLHLKP 505 >AL356793-3|CAI22559.1| 511|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >AL356793-2|CAI22558.1| 497|Homo sapiens cytochrome P450, family 4, subfamily B, polypeptide 1 protein. Length = 497 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 421 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 479 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 480 SKNGFHLHLKP 490 >AF491285-1|AAM09532.1| 511|Homo sapiens cytochrome P450 protein. Length = 511 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 ++ RH +AF+PFSAGPR+C+G ++AM ++KV+ + L F D K+ ++L+ Sbjct: 435 ASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKM-PQLVLR 493 Query: 516 RAEGFQVRLQP 484 GF + L+P Sbjct: 494 SKNGFHLHLKP 504 >AF467894-1|AAL67578.1| 520|Homo sapiens cytochrome P450, subfamily IVF, polypeptide 2 protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AC005336-1|AAC27730.1| 520|Homo sapiens CYP4F2 protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AB015306-1|BAA75823.1| 520|Homo sapiens Leukotriene B4 omega-hydroxylase protein. Length = 520 Score = 58.8 bits (136), Expect = 2e-08 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AY792513-1|AAV40834.1| 520|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 3 protein. Length = 520 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/64 (40%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AF054821-1|AAC08589.1| 520|Homo sapiens cytochrome P-450 protein. Length = 520 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/64 (40%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEP--RRKPELVLRAEGGIWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >D12620-1|BAA02144.1| 520|Homo sapiens cytochrome P-450LTBV protein. Length = 520 Score = 57.6 bits (133), Expect = 4e-08 Identities = 26/64 (40%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLAFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AB002461-1|BAA25991.1| 520|Homo sapiens leukotriene B4 omega-hydroxylase protein. Length = 520 Score = 57.6 bits (133), Expect = 4e-08 Identities = 26/64 (40%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLAFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AB002454-1|BAA25990.1| 520|Homo sapiens leukotriene B4 omega-hydroxylase protein. Length = 520 Score = 57.6 bits (133), Expect = 4e-08 Identities = 26/64 (40%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L L FRV+ D E + + +++L+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLAFRVLPDHTEP--RRKPELVLRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >BC028102-1|AAH28102.1| 509|Homo sapiens cytochrome P450, family 4, subfamily X, polypeptide 1 protein. Length = 509 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 436 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 494 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 495 PKNGMYLHLK 504 >BC016853-1|AAH16853.1| 524|Homo sapiens CYP4F11 protein protein. Length = 524 Score = 56.4 bits (130), Expect = 9e-08 Identities = 25/64 (39%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L +FR++ E + + ++IL+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHTEP--RRKPELILRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >AY358537-1|AAQ88901.1| 509|Homo sapiens EFSW1929 protein. Length = 509 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 436 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 494 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 495 PKNGMYLHLK 504 >AM040940-1|CAJ13826.1| 509|Homo sapiens cytochrome P450 protein. Length = 509 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 436 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 494 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 495 PKNGMYLHLK 504 >AL450996-1|CAH71035.1| 509|Homo sapiens cytochrome P450, family 4, subfamily X, polypeptide 1 protein. Length = 509 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 436 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 494 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 495 PKNGMYLHLK 504 >AK131355-1|BAD18508.1| 508|Homo sapiens protein ( Homo sapiens cDNA FLJ16384 fis, clone TLIVE2007607, weakly similar to CYTOCHROME P450 4A4 (EC 1.14.14.1). ). Length = 508 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 435 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 493 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 494 PKNGMYLHLK 503 >AK098065-1|BAC05226.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ40746 fis, clone TRACH2000359, weakly similar to CYTOCHROME P450 4A4 (EC 1.14.14.1). ). Length = 509 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 436 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 494 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 495 PKNGMYLHLK 504 >AK091806-1|BAC03751.1| 444|Homo sapiens protein ( Homo sapiens cDNA FLJ34487 fis, clone HLUNG2004273, weakly similar to CYTOCHROME P450 4A4 (EC 1.14.14.1). ). Length = 444 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = -2 Query: 696 SAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILK 517 S RH YA++PFSAG R+C+G ++AM++LKV ++ IL +FRV D ILK Sbjct: 371 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD-PTRPLTFPNHFILK 429 Query: 516 RAEGFQVRLQ 487 G + L+ Sbjct: 430 PKNGMYLHLK 439 >AF236085-1|AAG15889.1| 524|Homo sapiens CYP4F11 protein. Length = 524 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/64 (39%), Positives = 44/64 (68%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 AF+PFSAGPR+C+G +AM ++KV+L+ L +FR++ E + + ++IL+ G + Sbjct: 457 AFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHIEP--RRKPELILRAEGGLWL 514 Query: 495 RLQP 484 R++P Sbjct: 515 RVEP 518 >BC093896-1|AAH93896.1| 531|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 22 protein. Length = 531 Score = 53.6 bits (123), Expect = 6e-07 Identities = 23/64 (35%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A+VPFSAGPR+C+G +AM +L+V+++ L FR+ D + + + ++IL+ G + Sbjct: 464 AYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVD-RTRKVRRKPELILRTENGLWL 522 Query: 495 RLQP 484 +++P Sbjct: 523 KVEP 526 >BC093894-1|AAH93894.1| 531|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 22 protein. Length = 531 Score = 53.6 bits (123), Expect = 6e-07 Identities = 23/64 (35%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A+VPFSAGPR+C+G +AM +L+V+++ L FR+ D + + + ++IL+ G + Sbjct: 464 AYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVD-RTRKVRRKPELILRTENGLWL 522 Query: 495 RLQP 484 +++P Sbjct: 523 KVEP 526 >BC069351-1|AAH69351.1| 531|Homo sapiens cytochrome P450, family 4, subfamily F, polypeptide 22 protein. Length = 531 Score = 53.6 bits (123), Expect = 6e-07 Identities = 23/64 (35%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A+VPFSAGPR+C+G +AM +L+V+++ L FR+ D + + + ++IL+ G + Sbjct: 464 AYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVD-RTRKVRRKPELILRTENGLWL 522 Query: 495 RLQP 484 +++P Sbjct: 523 KVEP 526 >AK096820-1|BAC04868.1| 531|Homo sapiens protein ( Homo sapiens cDNA FLJ39501 fis, clone PROST2016980, moderately similar to CYTOCHROME P450 4F2 (EC 1.14.13.30). ). Length = 531 Score = 53.6 bits (123), Expect = 6e-07 Identities = 23/64 (35%), Positives = 43/64 (67%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQV 496 A+VPFSAGPR+C+G +AM +L+V+++ L FR+ D + + + ++IL+ G + Sbjct: 464 AYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVD-RTRKVRRKPELILRTENGLWL 522 Query: 495 RLQP 484 +++P Sbjct: 523 KVEP 526 >AY280371-1|AAQ21367.1| 519|Homo sapiens cytochrome P450 4A22K protein. Length = 519 Score = 51.2 bits (117), Expect = 3e-06 Identities = 24/69 (34%), Positives = 42/69 (60%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRTPIPM-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >S67580-1|AAB29502.1| 519|Homo sapiens fatty acid omega-hydroxylase protein. Length = 519 Score = 50.4 bits (115), Expect = 6e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >L04751-1|AAA58436.1| 519|Homo sapiens cytochrome P450 protein. Length = 519 Score = 50.4 bits (115), Expect = 6e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >D26481-1|BAA05491.1| 519|Homo sapiens fatty acids omega-hydroxylase protein. Length = 519 Score = 50.4 bits (115), Expect = 6e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AY369778-1|AAQ56847.1| 519|Homo sapiens cytochrome P450, family 4, subfamily A, polypeptide 11 protein. Length = 519 Score = 50.4 bits (115), Expect = 6e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AL731892-3|CAH72778.1| 519|Homo sapiens cytochrome P450, family 4, subfamily A, polypeptide 11 protein. Length = 519 Score = 50.4 bits (115), Expect = 6e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AF525488-1|AAO16078.1| 519|Homo sapiens cytochrome P450, subfamily IVA, polypeptide 11 protein. Length = 519 Score = 50.4 bits (115), Expect = 6e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AY280372-1|AAQ21368.1| 519|Homo sapiens cytochrome P450 4A22 protein. Length = 519 Score = 50.0 bits (114), Expect = 8e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPM-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AL135960-10|CAI19736.1| 421|Homo sapiens cytochrome P450, family 4, subfamily A, polypeptide 22 protein. Length = 421 Score = 50.0 bits (114), Expect = 8e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 342 SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPM-ARLVLKS 400 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 401 KNGIHLRLR 409 >AL135960-9|CAI19737.1| 519|Homo sapiens cytochrome P450, family 4, subfamily A, polypeptide 22 protein. Length = 519 Score = 50.0 bits (114), Expect = 8e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPM-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AF208532-1|AAF76722.1| 519|Homo sapiens fatty acid omega-hydroxylase CYP4A11 protein. Length = 519 Score = 50.0 bits (114), Expect = 8e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKR 514 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPI-ARLVLKS 498 Query: 513 AEGFQVRLQ 487 G +RL+ Sbjct: 499 KNGIHLRLR 507 >AY358631-1|AAQ88994.1| 505|Homo sapiens EPSW3060 protein. Length = 505 Score = 47.2 bits (107), Expect = 6e-05 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEG 505 H YAF+PFSAG R+C+G +A+++ KV ++ L F++ D ++ ++LK G Sbjct: 438 HPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVR-QVVLKSKNG 496 Query: 504 FQV 496 V Sbjct: 497 IHV 499 >AY262056-1|AAO89257.1| 505|Homo sapiens cytochrome P450 protein. Length = 505 Score = 47.2 bits (107), Expect = 6e-05 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEG 505 H YAF+PFSAG R+C+G +A+++ KV ++ L F++ D ++ ++LK G Sbjct: 438 HPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVR-QVVLKSKNG 496 Query: 504 FQV 496 V Sbjct: 497 IHV 499 >AL450996-2|CAH71036.1| 505|Homo sapiens cytochrome P450, family 4, subfamily Z, polypeptide 1 protein. Length = 505 Score = 47.2 bits (107), Expect = 6e-05 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEG 505 H YAF+PFSAG R+C+G +A+++ KV ++ L F++ D ++ ++LK G Sbjct: 438 HPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVR-QVVLKSKNG 496 Query: 504 FQV 496 V Sbjct: 497 IHV 499 >AL135960-6|CAI19734.1| 505|Homo sapiens cytochrome P450, family 4, subfamily Z, polypeptide 1 protein. Length = 505 Score = 47.2 bits (107), Expect = 6e-05 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEG 505 H YAF+PFSAG R+C+G +A+++ KV ++ L F++ D ++ ++LK G Sbjct: 438 HPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVR-QVVLKSKNG 496 Query: 504 FQV 496 V Sbjct: 497 IHV 499 >J04813-1|AAA02993.1| 502|Homo sapiens cytochrome P450 PCN3 protein. Length = 502 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 429 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 477 >BC033862-1|AAH33862.1| 502|Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 5 protein. Length = 502 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 429 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 477 >AK223008-1|BAD96728.1| 502|Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 5 variant protein. Length = 502 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 429 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 477 >AJ563379-2|CAD91649.1| 84|Homo sapiens cytochrome P450 protein. Length = 84 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 11 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 59 >AJ563378-3|CAD91347.1| 173|Homo sapiens hypothetical protein protein. Length = 173 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 100 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 148 >AJ563378-2|CAD91647.1| 160|Homo sapiens cytochrome P450 protein. Length = 160 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 87 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 135 >AC005020-1|AAS02016.1| 502|Homo sapiens unknown protein. Length = 502 Score = 46.4 bits (105), Expect = 1e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y + PF GPR+C+G ++A++ +K+ L +L+NF KE+ L+ D Sbjct: 429 YIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLD 477 >M14096-1|AAA35744.1| 503|Homo sapiens protein ( Human cytochrome P-450 nifedipine oxidase mRNA, complet cds. ). Length = 503 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YTYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >J04449-1|AAA35747.1| 502|Homo sapiens cytochrome P450 nifedipine oxidase protein. Length = 502 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 429 YTYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 478 >X12387-1|CAA30944.1| 503|Homo sapiens protein ( Human mRNA for cytochrome P-450 (cyp3 locus). ). Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >M18907-1|AAA35745.1| 503|Homo sapiens protein ( Human P450 mRNA encoding nifedipine oxidase, complete cds. ). Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >M13785-1|AAA35742.1| 504|Homo sapiens protein ( Human liver glucocorticoid-inducible cytochrome P-450 (HLp) mRNA, complete cds. ). Length = 504 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 431 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 480 >D13705-1|BAA02864.1| 521|Homo sapiens fatty acid omega-hydroxylase protein. Length = 521 Score = 45.2 bits (102), Expect = 2e-04 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTI-LRNFRVISDLKESDFKLQADIILK 517 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D + A ++LK Sbjct: 441 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVGQQALTLVRFELLPDPTRIPIPI-ARLVLK 499 Query: 516 RAEGFQVRLQ 487 G +RL+ Sbjct: 500 SKNGIHLRLR 509 >D00003-1|BAA00001.1| 504|Homo sapiens cytochrome P-450 protein. Length = 504 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 431 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 480 >DQ924960-1|ABI96208.1| 503|Homo sapiens cytochrome P450 family 3 subfamily A polypeptide 4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >DQ005611-1|AAY16980.1| 503|Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >BC101631-1|AAI01632.1| 503|Homo sapiens cytochrome P450, subfamily IIIA, polypeptide 4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >BC100981-1|AAI00982.1| 393|Homo sapiens CYP3A43 protein protein. Length = 393 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 320 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 368 >BC069418-1|AAH69418.1| 503|Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >AY390425-1|AAQ92353.1| 503|Homo sapiens cytochrome P450 CYP3A43.1 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 430 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 478 >AY390424-1|AAQ92352.1| 503|Homo sapiens cytochrome P450 CYP3A43.3 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 430 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 478 >AJ563377-1|CAD91345.1| 353|Homo sapiens cytochrome P450 protein. Length = 353 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 280 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 329 >AJ563376-2|CAD91645.1| 430|Homo sapiens cytochrome P450 protein. Length = 430 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 357 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 406 >AJ563375-1|CAD91343.1| 503|Homo sapiens cytochrome P450 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >AF337813-1|AAK38841.1| 503|Homo sapiens cytochrome P450 subfamily IIIA polypeptide 43 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 430 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 478 >AF319634-1|AAK00325.1| 503|Homo sapiens cytochrome P450 CYP3A43 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 430 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 478 >AF280109-1|AAG33010.1| 504|Homo sapiens cytochrome P450 subfamily IIIA polypeptide 43 protein. Length = 504 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 431 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 479 >AF280108-1|AAG33009.1| 503|Homo sapiens cytochrome P450 subfamily IIIA polypeptide 43 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 430 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 478 >AF280107-2|AAG32290.1| 503|Homo sapiens cytochrome P450 polypeptide 4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >AF209389-1|AAF21034.1| 503|Homo sapiens cytochrome P450 IIIA4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >AF182273-1|AAF13598.1| 503|Homo sapiens cytochrome P450-3A4 protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADI 526 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ + Sbjct: 430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS-FKPCKETQIPLKLSL 479 >AC011904-5|AAS07394.1| 504|Homo sapiens unknown protein. Length = 504 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 431 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 479 >AC011904-4|AAS07395.1| 503|Homo sapiens unknown protein. Length = 503 Score = 45.2 bits (102), Expect = 2e-04 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQAD 529 Y ++PF AGPR+C+G ++A+ +K+ + L+NF KE+ L+ D Sbjct: 430 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFS-FKPCKETQIPLKLD 478 >S67581-1|AAB29503.1| 591|Homo sapiens fatty acid omega-hydroxylase protein. Length = 591 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/44 (40%), Positives = 30/44 (68%) Frame = -2 Query: 693 AXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISD 562 + +H +AF+PFS G R+C+G ++AM +LKV + L F ++ D Sbjct: 440 SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPD 483 >D00408-1|BAA00310.1| 503|Homo sapiens cytochrome P-450 HFLa protein. Length = 503 Score = 44.4 bits (100), Expect = 4e-04 Identities = 17/48 (35%), Positives = 31/48 (64%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQ 535 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ Sbjct: 430 YIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFS-FKPCKETQIPLK 476 >BC067436-1|AAH67436.1| 503|Homo sapiens cytochrome P450, family 3, subfamily A, polypeptide 7 protein. Length = 503 Score = 44.4 bits (100), Expect = 4e-04 Identities = 17/48 (35%), Positives = 31/48 (64%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQ 535 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ Sbjct: 430 YIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFS-FKPCKETQIPLK 476 >AF315325-1|AAG48618.1| 535|Homo sapiens cytochrome P450 variant 3A7 protein. Length = 535 Score = 44.4 bits (100), Expect = 4e-04 Identities = 17/48 (35%), Positives = 31/48 (64%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQ 535 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ Sbjct: 430 YIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFS-FKPCKETQIPLK 476 >AF280107-3|AAG32289.1| 503|Homo sapiens cytochrome P450 polypeptide 7 protein. Length = 503 Score = 44.4 bits (100), Expect = 4e-04 Identities = 17/48 (35%), Positives = 31/48 (64%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQ 535 Y + PF +GPR+C+G ++A++ +K+ L +L+NF KE+ L+ Sbjct: 430 YIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFS-FKPCKETQIPLK 476 >AC005336-2|AAC27731.1| 93|Homo sapiens F20191_1, partial CDS protein. Length = 93 Score = 44.0 bits (99), Expect = 5e-04 Identities = 20/67 (29%), Positives = 39/67 (58%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEG 505 H + P GP +C+G +AM ++KV+L+ L +FR++ E + + ++IL+ G Sbjct: 23 HLWLLFPSRQGPGNCIGQAFAMAEMKVVLALTLLHFRILPTHTEP--RRKPELILRAEGG 80 Query: 504 FQVRLQP 484 +R++P Sbjct: 81 LWLRVEP 87 >M29874-1|AAA52144.1| 491|Homo sapiens CYP2B protein. Length = 491 Score = 42.3 bits (95), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL--QADIILKRAEGF 502 AF+PFS G R C+G A +L + +TIL+NF + S + D L Q + K + Sbjct: 425 AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTY 484 Query: 501 QVRLQPR 481 Q+R PR Sbjct: 485 QIRFLPR 491 >DQ298753-1|ABB84469.1| 491|Homo sapiens cytochrome P450, family 2, subfamily B, polypeptide 6 protein. Length = 491 Score = 42.3 bits (95), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL--QADIILKRAEGF 502 AF+PFS G R C+G A +L + +TIL+NF + S + D L Q + K + Sbjct: 425 AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTY 484 Query: 501 QVRLQPR 481 Q+R PR Sbjct: 485 QIRFLPR 491 >BC067431-1|AAH67431.1| 491|Homo sapiens cytochrome P450, family 2, subfamily B, polypeptide 6 protein. Length = 491 Score = 42.3 bits (95), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL--QADIILKRAEGF 502 AF+PFS G R C+G A +L + +TIL+NF + S + D L Q + K + Sbjct: 425 AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTY 484 Query: 501 QVRLQPR 481 Q+R PR Sbjct: 485 QIRFLPR 491 >BC067430-1|AAH67430.1| 491|Homo sapiens cytochrome P450, family 2, subfamily B, polypeptide 6 protein. Length = 491 Score = 42.3 bits (95), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL--QADIILKRAEGF 502 AF+PFS G R C+G A +L + +TIL+NF + S + D L Q + K + Sbjct: 425 AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTY 484 Query: 501 QVRLQPR 481 Q+R PR Sbjct: 485 QIRFLPR 491 >BC022539-1|AAH22539.1| 500|Homo sapiens cytochrome P450, family 46, subfamily A, polypeptide 1 protein. Length = 500 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR--NFRVISDLKESDFKLQADIILKRAEG 505 + + PFS G RSC+G ++A +++KV+++ +L+ FR++ + F LQ LK + Sbjct: 425 FTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQR---FGLQEQATLKPLDP 481 Query: 504 FQVRLQPR 481 L+PR Sbjct: 482 VLCTLRPR 489 >AK090886-1|BAC03539.1| 337|Homo sapiens protein ( Homo sapiens cDNA FLJ33567 fis, clone BRAMY2010272, highly similar to Homo sapiens cholesterol 24-hydroxylase mRNA. ). Length = 337 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR--NFRVISDLKESDFKLQADIILKRAEG 505 + + PFS G RSC+G ++A +++KV+++ +L+ FR++ + F LQ LK + Sbjct: 262 FTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQR---FGLQEQATLKPLDP 318 Query: 504 FQVRLQPR 481 L+PR Sbjct: 319 VLCTLRPR 326 >AF182277-1|AAF13602.1| 491|Homo sapiens cytochrome P450-2B6 protein. Length = 491 Score = 42.3 bits (95), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL--QADIILKRAEGF 502 AF+PFS G R C+G A +L + +TIL+NF + S + D L Q + K + Sbjct: 425 AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTY 484 Query: 501 QVRLQPR 481 Q+R PR Sbjct: 485 QIRFLPR 491 >AF094480-1|AAD41244.1| 500|Homo sapiens cholesterol 24-hydroxylase protein. Length = 500 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR--NFRVISDLKESDFKLQADIILKRAEG 505 + + PFS G RSC+G ++A +++KV+++ +L+ FR++ + F LQ LK + Sbjct: 425 FTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQR---FGLQEQATLKPLDP 481 Query: 504 FQVRLQPR 481 L+PR Sbjct: 482 VLCTLRPR 489 >AC023172-1|AAF32444.1| 491|Homo sapiens CYP2B6 protein. Length = 491 Score = 42.3 bits (95), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL--QADIILKRAEGF 502 AF+PFS G R C+G A +L + +TIL+NF + S + D L Q + K + Sbjct: 425 AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTY 484 Query: 501 QVRLQPR 481 Q+R PR Sbjct: 485 QIRFLPR 491 >Y07508-1|CAA68807.1| 503|Homo sapiens protein ( Human mRNA for aromatase P-450. ). Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >X13589-1|CAA31929.1| 503|Homo sapiens protein ( Human mRNA for aromatase (estrogen synthetase). ). Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >M80647-1|AAA60618.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >M61856-1|AAB59356.1| 490|Homo sapiens cytochrome protein. Length = 490 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 469 >M30804-1|AAA35728.1| 503|Homo sapiens protein ( Human aromatase cytochrome P-450 gene, exon 10. ). Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >M28420-1|AAA52141.1| 419|Homo sapiens cytochrome P-450 aromatase protein. Length = 419 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 340 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 376 >M22246-1|AAA35557.1| 503|Homo sapiens protein ( Human aromatase mRNA, complete cds. ). Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >M18856-1|AAA35556.1| 419|Homo sapiens protein ( Human aromatase (Aro1) mRNA, complete cds. ). Length = 419 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 340 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 376 >L16876-1|AAA02630.1| 490|Homo sapiens cytochrome P-4502C18 protein. Length = 490 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 469 >J04127-1|AAA52132.1| 503|Homo sapiens CYP19 protein. Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >DQ118405-1|AAZ23558.1| 503|Homo sapiens cytochrome P450 subfamily 19 subfamily A polypeptide 1 protein. Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >BX538127-1|CAD98029.1| 310|Homo sapiens hypothetical protein protein. Length = 310 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 245 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 289 >BC107785-1|AAI07786.1| 503|Homo sapiens cytochrome P450, family 19, subfamily A, polypeptide 1 protein. Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >BC096260-1|AAH96260.1| 431|Homo sapiens CYP2C18 protein protein. Length = 431 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 366 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 410 >BC096258-1|AAH96258.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 18 protein. Length = 490 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 469 >BC096257-1|AAH96257.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 18 protein. Length = 490 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 469 >BC069666-1|AAH69666.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 18 protein. Length = 490 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 469 >BC041157-1|AAH41157.1| 534|Homo sapiens thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A) protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >BC035959-1|AAH35959.1| 503|Homo sapiens cytochrome P450, family 19, subfamily A, polypeptide 1 protein. Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >BC014117-1|AAH14117.1| 466|Homo sapiens TBXAS1 protein protein. Length = 466 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 400 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 434 >AY957953-1|AAX44046.1| 503|Homo sapiens cytochrome P450, family 19, subfamily A, polypeptide 1 protein. Length = 503 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = -2 Query: 681 YYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 Y F PF GPR C G AM+ +K IL T+LR F V Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460 >AL583836-1|CAH74067.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 18 protein. Length = 490 Score = 41.5 bits (93), Expect = 0.003 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDI 469 >AK223466-1|BAD97186.1| 534|Homo sapiens thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A) iso protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233625-1|AAF99279.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233624-1|AAF99278.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233623-1|AAF99277.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233622-1|AAF99276.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233621-1|AAF99275.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233620-1|AAF99274.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233619-1|AAF99273.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233618-1|AAF99272.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233617-1|AAF99271.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233616-1|AAF99270.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AF233615-1|AAF99269.1| 534|Homo sapiens thromboxane synthase protein. Length = 534 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G + +L++K+ L +L FR Sbjct: 468 FTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFR 502 >AK223510-1|BAD97230.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 18 variant protein. Length = 490 Score = 41.1 bits (92), Expect = 0.004 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKL 538 F+PFSAG R C+G A ++L + L+TIL+NF + S + D + Sbjct: 425 FMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSKVDPKDIDI 469 >Y00498-1|CAA68550.1| 490|Homo sapiens IIC2 protein. Length = 490 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 425 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 484 Query: 498 VRLQP 484 + P Sbjct: 485 ICFIP 489 >X51535-1|CAA35915.1| 210|Homo sapiens cytochrome P-450 HPH (120 AA) protein. Length = 210 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 145 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 204 Query: 498 VRLQP 484 + P Sbjct: 205 ICFIP 209 >X13930-1|CAA32118.1| 494|Homo sapiens protein ( Human CYP2A4 mRNA for P-450 IIA4 protein. ). Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >X13929-1|CAA32117.1| 448|Homo sapiens P-450 IIA3 protein (1 is 3rd base in codon) protein. Length = 448 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 382 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 424 >X13897-1|CAA32097.1| 489|Homo sapiens protein ( Human mRNA for cytochrome P-450IIA. ). Length = 489 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 423 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 465 >M33318-1|AAA52067.1| 494|Homo sapiens CYP2A protein. Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >M21942-1|AAA52161.1| 462|Homo sapiens CYP2C protein. Length = 462 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 397 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 456 Query: 498 VRLQP 484 + P Sbjct: 457 ICFIP 461 >M21941-1|AAA52160.1| 480|Homo sapiens CYP2C protein. Length = 480 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 415 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 474 Query: 498 VRLQP 484 + P Sbjct: 475 ICFIP 479 >M17397-1|AAA35739.1| 490|Homo sapiens protein ( Human cytochrome P-450 1 functional form mRNA, complete cds. ). Length = 490 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 425 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 484 Query: 498 VRLQP 484 + P Sbjct: 485 ICFIP 489 >D34625-1|BAA07011.1| 533|Homo sapiens thromboxane synthase protein. Length = 533 Score = 40.3 bits (90), Expect = 0.006 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFR 574 + ++PF AGPRSC+G +L++K+ L +L FR Sbjct: 467 FTYLPFGAGPRSCLGVHLGLLEVKLTLLHVLHKFR 501 >BC096256-1|AAH96256.1| 494|Homo sapiens cytochrome P450, family 2, subfamily A, polypeptide 6 protein. Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >BC096255-1|AAH96255.1| 494|Homo sapiens cytochrome P450, family 2, subfamily A, polypeptide 6 protein. Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >BC096254-1|AAH96254.1| 494|Homo sapiens cytochrome P450, family 2, subfamily A, polypeptide 6 protein. Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >BC096253-1|AAH96253.3| 494|Homo sapiens cytochrome P450, family 2, subfamily A, polypeptide 6 protein. Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >BC020596-1|AAH20596.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 8 protein. Length = 490 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 425 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 484 Query: 498 VRLQP 484 + P Sbjct: 485 ICFIP 489 >AY514490-1|AAR89907.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 8 protein. Length = 490 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 425 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 484 Query: 498 VRLQP 484 + P Sbjct: 485 ICFIP 489 >AL359672-5|CAH71307.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 8 protein. Length = 490 Score = 40.3 bits (90), Expect = 0.006 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV--ISDLKESDFKLQADIILKRAEGFQ 499 F+PFSAG R C G A ++L + L+TIL+NF + + DLK + I+ +Q Sbjct: 425 FMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQ 484 Query: 498 VRLQP 484 + P Sbjct: 485 ICFIP 489 >AF182275-1|AAF13600.1| 494|Homo sapiens cytochrome P450-2A6 protein. Length = 494 Score = 40.3 bits (90), Expect = 0.006 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >X59812-1|CAA42481.1| 530|Homo sapiens Vitamin D3 25-hydroxylase protein. Length = 530 Score = 39.9 bits (89), Expect = 0.009 Identities = 16/56 (28%), Positives = 36/56 (64%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 +H + VPF G R+C+G + A L+++++L+ +++ ++V+ + + K A I+L Sbjct: 460 QHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVL 515 >M62401-1|AAA52142.1| 531|Homo sapiens sterol 27-hydroxylase protein. Length = 531 Score = 39.9 bits (89), Expect = 0.009 Identities = 16/56 (28%), Positives = 36/56 (64%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 +H + VPF G R+C+G + A L+++++L+ +++ ++V+ + + K A I+L Sbjct: 461 QHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVL 516 >BC051851-1|AAH51851.1| 531|Homo sapiens cytochrome P450, family 27, subfamily A, polypeptide 1 protein. Length = 531 Score = 39.9 bits (89), Expect = 0.009 Identities = 16/56 (28%), Positives = 36/56 (64%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 +H + VPF G R+C+G + A L+++++L+ +++ ++V+ + + K A I+L Sbjct: 461 QHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVL 516 >BC040430-1|AAH40430.1| 531|Homo sapiens cytochrome P450, family 27, subfamily A, polypeptide 1 protein. Length = 531 Score = 39.9 bits (89), Expect = 0.009 Identities = 16/56 (28%), Positives = 36/56 (64%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 +H + VPF G R+C+G + A L+++++L+ +++ ++V+ + + K A I+L Sbjct: 461 QHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVL 516 >AY178622-1|AAO21126.1| 531|Homo sapiens steroid hydroxylase protein. Length = 531 Score = 39.9 bits (89), Expect = 0.009 Identities = 16/56 (28%), Positives = 36/56 (64%) Frame = -2 Query: 687 RHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 +H + VPF G R+C+G + A L+++++L+ +++ ++V+ + + K A I+L Sbjct: 461 QHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVL 516 >M33317-1|AAA52138.1| 494|Homo sapiens CYP2A protein. Length = 494 Score = 39.5 bits (88), Expect = 0.011 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQA 532 AFVPFS G R C G A ++L + +T+++NFR+ S D + + Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSS 475 >X58906-1|CAA41709.1| 495|Homo sapiens steroid 21-monooxygenase protein. Length = 495 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS--DLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++S D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLSSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >BC117165-1|AAI17166.1| 494|Homo sapiens cytochrome P450, family 2, subfamily A, polypeptide 7 protein. Length = 494 Score = 39.1 bits (87), Expect = 0.015 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >U22028-1|AAB40519.1| 494|Homo sapiens cytochrome P450 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >AY513609-1|AAR90940.1| 494|Homo sapiens cytochrome P450 2A13 variant 6 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >AY513608-1|AAR90939.1| 494|Homo sapiens cytochrome P450 2A13 variant 5 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >AY513606-1|AAR90937.1| 494|Homo sapiens cytochrome P450 2A13 variant 3 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >AY513605-1|AAR90936.1| 494|Homo sapiens cytochrome P450 2A13 variant 2 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >AY513604-1|AAR90935.1| 494|Homo sapiens cytochrome P450 2A13 variant 1 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >AF209774-1|AAG35775.1| 494|Homo sapiens cytochrome P450 2A13 protein. Length = 494 Score = 38.3 bits (85), Expect = 0.026 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G R C G A ++L + +TI++NFR S D Sbjct: 428 AFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKD 470 >X65962-1|CAA46778.1| 356|Homo sapiens cytochrome P-450 II C protein. Length = 356 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 291 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 332 >U51692-1|AAC50951.1| 503|Homo sapiens lanosterol 14-alpha demethylase protein. Length = 503 Score = 37.9 bits (84), Expect = 0.034 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR 583 +A+VPF AG C+G +A +++K I ST+LR Sbjct: 437 FAYVPFGAGRHRCIGENFAYVQIKTIWSTMLR 468 >U23942-1|AAB39951.1| 509|Homo sapiens lanosterol 14-demethylase cytochrome P450 protein. Length = 509 Score = 37.9 bits (84), Expect = 0.034 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR 583 +A+VPF AG C+G +A +++K I ST+LR Sbjct: 443 FAYVPFGAGRHRCIGENFAYVQIKTIWSTMLR 474 >S46963-1|AAB23864.2| 477|Homo sapiens cytochrome P-450 protein. Length = 477 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 412 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 447 >M61858-1|AAA52145.1| 370|Homo sapiens CYP2C17 protein. Length = 370 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 305 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 346 >M61854-1|AAB59426.1| 490|Homo sapiens cytochrome protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 425 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 466 >M21940-1|AAA52159.1| 383|Homo sapiens CYP2C protein. Length = 383 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 318 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 353 >M21939-1|AAA52158.1| 485|Homo sapiens CYP2C protein. Length = 485 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 420 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 455 >M15331-1|AAA52157.1| 485|Homo sapiens CYP2C protein. Length = 485 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 420 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 455 >L39102-1|AAL31348.1| 217|Homo sapiens S-mephenytoin 4-hydroxylase protein. Length = 217 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 152 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 193 >L16883-1|AAD13467.1| 169|Homo sapiens cytochrome P-450 2C protein. Length = 169 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 104 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 139 >L07093-1|AAA36660.1| 468|Homo sapiens cytochrome P450 protein. Length = 468 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 403 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 444 >D55653-1|BAA09512.1| 509|Homo sapiens lanosterol 14-demethylase protein. Length = 509 Score = 37.9 bits (84), Expect = 0.034 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR 583 +A+VPF AG C+G +A +++K I ST+LR Sbjct: 443 FAYVPFGAGRHRCIGENFAYVQIKTIWSTMLR 474 >D00173-1|BAA00123.1| 487|Homo sapiens cytochrome P-450 protein. Length = 487 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 422 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 457 >BC125054-1|AAI25055.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 9 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 425 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 460 >BC032322-1|AAH32322.1| 509|Homo sapiens cytochrome P450, family 51, subfamily A, polypeptide 1 protein. Length = 509 Score = 37.9 bits (84), Expect = 0.034 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR 583 +A+VPF AG C+G +A +++K I ST+LR Sbjct: 443 FAYVPFGAGRHRCIGENFAYVQIKTIWSTMLR 474 >AY796203-1|AAV41877.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 19 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 425 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 466 >AY702706-1|AAT94065.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 9 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 425 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 460 >AY341248-1|AAP88931.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 9 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 425 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 460 >AY288916-1|AAP31972.1| 508|Homo sapiens cytochrome P450, family 27, subfamily B, polypeptide 1 protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AL583836-2|CAH74068.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 19 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 425 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 466 >AL359672-1|CAH71303.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 9 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVIS 565 F+PFSAG R CVG A ++L + L++IL+NF + S Sbjct: 425 FMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKS 460 >AL133513-2|CAH73444.1| 490|Homo sapiens cytochrome P450, family 2, subfamily C, polypeptide 19 protein. Length = 490 Score = 37.9 bits (84), Expect = 0.034 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = -2 Query: 672 FVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 F+PFSAG R CVG A ++L + L+ IL+NF + S + D Sbjct: 425 FMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKD 466 >AF256213-1|AAG00416.1| 508|Homo sapiens 25- hydroxyvitamin D-1-alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AF246895-1|AAF64299.1| 508|Homo sapiens 25-hydroxyvitamin D-1-alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AF027152-1|AAC51854.1| 508|Homo sapiens P450 25-hydroxyvitamin D-1 alpha hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AF020192-1|AAC51853.1| 508|Homo sapiens 25-hydroxyvitamin D-1-alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AC000120-2|AAB46356.1| 509|Homo sapiens unknown protein. Length = 509 Score = 37.9 bits (84), Expect = 0.034 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -2 Query: 678 YAFVPFSAGPRSCVGCKYAMLKLKVILSTILR 583 +A+VPF AG C+G +A +++K I ST+LR Sbjct: 443 FAYVPFGAGRHRCIGENFAYVQIKTIWSTMLR 474 >AB006987-1|BAA23418.1| 508|Homo sapiens 25-hydroxyvitamin D3 1-alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AB005990-1|BAA22657.1| 508|Homo sapiens 25-hydroxyvitamin D3 1alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AB005989-1|BAA22656.1| 508|Homo sapiens 25-hydroxyvitamin D3 1alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >AB005038-1|BAA23416.1| 508|Homo sapiens 25-hydroxyvitamin D3 1-alpha-hydroxylase protein. Length = 508 Score = 37.9 bits (84), Expect = 0.034 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -2 Query: 684 HYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRV 571 H +A +PF G RSC+G + A L+L++ L+ IL +F V Sbjct: 441 HPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEV 478 >M28548-1|AAA52065.1| 495|Homo sapiens protein ( Human mutant 21-hydroxylase B gene, complete cds. ). Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >M26856-1|AAA52064.1| 495|Homo sapiens protein ( Human 21-hydroxylase B gene, complete cds. ). Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >M21550-1|AAA52063.1| 495|Homo sapiens CYP21 protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >M17252-1|AAA59985.1| 230|Homo sapiens CYP21 protein. Length = 230 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 157 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 216 Query: 489 QPR 481 QPR Sbjct: 217 QPR 219 >M13936-1|AAA59695.1| 494|Homo sapiens CYP21P protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >K03192-1|AAA52147.1| 331|Homo sapiens CYP1A1 protein. Length = 331 Score = 37.5 bits (83), Expect = 0.046 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS G +C G A ++L + +T+++NFR+ S D Sbjct: 265 AFVPFSIGQPNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 307 >BX679671-8|CAM26070.1| 494|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >BX679671-7|CAM26071.1| 464|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 464 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 391 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 450 Query: 489 QPR 481 QPR Sbjct: 451 QPR 453 >BC128535-1|AAI28536.1| 143|Homo sapiens CYP21A2 protein protein. Length = 143 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 70 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 129 Query: 489 QPR 481 QPR Sbjct: 130 QPR 132 >BC125182-1|AAI25183.1| 494|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >BC125181-1|AAI25182.1| 495|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >AM183951-1|CAJ75805.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKIQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM183950-1|CAJ75804.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM183949-1|CAJ75803.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM183948-1|CAJ75802.1| 494|Homo sapiens steroid 21-hydroxylase protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM183947-1|CAJ75801.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM183946-1|CAJ75800.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM183945-1|CAJ75799.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM086565-1|CAJ31104.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AM086564-1|CAJ31103.1| 494|Homo sapiens steroid 21-hydroxylase, CYP21 protein. Length = 494 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 421 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480 Query: 489 QPR 481 QPR Sbjct: 481 QPR 483 >AL929593-2|CAI41778.1| 465|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 465 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 392 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 451 Query: 489 QPR 481 QPR Sbjct: 452 QPR 454 >AL929593-1|CAI41779.1| 495|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >AL662849-19|CAI17480.1| 465|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 465 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 392 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 451 Query: 489 QPR 481 QPR Sbjct: 452 QPR 454 >AL662849-18|CAI17479.1| 495|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >AL645922-24|CAI41754.1| 495|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >AL645922-23|CAI41755.1| 465|Homo sapiens cytochrome P450, family 21, subfamily A, polypeptide 2 protein. Length = 465 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 392 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 451 Query: 489 QPR 481 QPR Sbjct: 452 QPR 454 >AL049547-7|CAB89301.1| 495|Homo sapiens dJ34F7.3 (cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital a protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >AK054616-1|BAB70774.1| 465|Homo sapiens protein ( Homo sapiens cDNA FLJ30054 fis, clone ADRGL1000160, highly similar to CYTOCHROME P450 XXIB (EC 1.14.99.10). ). Length = 465 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 392 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 451 Query: 489 QPR 481 QPR Sbjct: 452 QPR 454 >AF077974-1|AAD45405.1| 403|Homo sapiens cytochrome P450 21-hydroxylase protein. Length = 403 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 330 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 389 Query: 489 QPR 481 QPR Sbjct: 390 QPR 392 >AF019413-2|AAB67982.1| 495|Homo sapiens cytochrome P450 21-hydroxylase protein. Length = 495 Score = 37.5 bits (83), Expect = 0.046 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = -2 Query: 663 FSAGPRSCVGCKYAMLKLKVILSTILRNFRVI--SDLKESDFKLQADIILKRAEGFQVRL 490 F G R C+G A L+L V+L+ +L+ F ++ D S L ++ + + FQVRL Sbjct: 422 FGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 481 Query: 489 QPR 481 QPR Sbjct: 482 QPR 484 >U22029-1|AAB40520.1| 494|Homo sapiens cytochrome P450 protein. Length = 494 Score = 37.1 bits (82), Expect = 0.060 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIRKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >U22027-1|AAB40518.1| 494|Homo sapiens cytochrome P450 protein. Length = 494 Score = 37.1 bits (82), Expect = 0.060 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -2 Query: 675 AFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESD 547 AFVPFS R+C G A ++L + +T+++NFR+ S D Sbjct: 428 AFVPFSIRKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKD 470 >X55764-1|CAA39290.1| 503|Homo sapiens protein ( Human mRNA for cytochrome P-450 (11 Beta). ). Length = 503 Score = 36.3 bits (80), Expect = 0.11 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 R + R++Y VPF G R C+G + A ++ ++L +L++ +V L + D K+ IL Sbjct: 432 RGSGRNFY-HVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQV-ETLTQEDIKMVYSFIL 489 Query: 519 K 517 + Sbjct: 490 R 490 >X54741-1|CAA38539.1| 503|Homo sapiens aldosterone synthase (P-450aldo) protein. Length = 503 Score = 36.3 bits (80), Expect = 0.11 Identities = 18/61 (29%), Positives = 36/61 (59%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 R + R+++ VPF G R C+G + A ++ ++L +L++F ++ L + D K+ IL Sbjct: 432 RGSGRNFH-HVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHF-LVETLTQEDIKMVYSFIL 489 Query: 519 K 517 + Sbjct: 490 R 490 >M32879-1|AAA52149.1| 503|Homo sapiens CYP11B1 protein. Length = 503 Score = 36.3 bits (80), Expect = 0.11 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = -2 Query: 699 RSAXRHYYAFVPFSAGPRSCVGCKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIIL 520 R + R++Y VPF G R C+G + A ++ ++L +L++ +V L + D K+ IL Sbjct: 432 RGSGRNFY-HVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQV-ETLTQEDIKMVYSFIL 489 Query: 519 K 517 + Sbjct: 490 R 490 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,071,479 Number of Sequences: 237096 Number of extensions: 1177957 Number of successful extensions: 2180 Number of sequences better than 10.0: 340 Number of HSP's better than 10.0 without gapping: 2152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2180 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -