BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_pT_A05 (491 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine r... 27 5.6 Z69883-3|CAA93741.2| 450|Caenorhabditis elegans Hypothetical pr... 27 9.8 >AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine receptor, class j protein49 protein. Length = 330 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 150 FALIFLAEYSSILFIRMILVIINMGGYNLRFFFYLK 43 F L+F A ++ I + L+ I++ Y FF +LK Sbjct: 42 FLLLFFAVFNMIYSVMNFLIQIDIHSYRYCFFLFLK 77 >Z69883-3|CAA93741.2| 450|Caenorhabditis elegans Hypothetical protein C27C12.4 protein. Length = 450 Score = 26.6 bits (56), Expect = 9.8 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -3 Query: 126 YSSILFIRMILVIINMGGYNLRFFFYLKLRL 34 YSS LF+ L+I+ +G FFF LK+RL Sbjct: 406 YSSFLFLPSQLLILTIGCVASTFFF-LKVRL 435 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,786,015 Number of Sequences: 27780 Number of extensions: 73098 Number of successful extensions: 179 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 179 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 924715866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -