BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P22 (602 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 4.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.0 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 302 CTEPLRSR*IFKSRHFEIKITNYIVYMYTLCRYL 201 C + +S F RH NYI + Y L YL Sbjct: 136 CVQTEKSVFDFLCRHTVEYFQNYIHFFYQLLLYL 169 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +1 Query: 493 DETNLYDLNLNRDPQQRPSSASHRSPKMYSXTH 591 DE + + + + +PS + SP+ + TH Sbjct: 894 DERSFHSNGAKEEDEDKPSVSPLTSPRQPAETH 926 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,586 Number of Sequences: 336 Number of extensions: 2526 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -