BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P17 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.07 |meu6||meiotic chromosome segregation protein Meu6|Sc... 28 1.3 SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 27 1.7 SPAC2F3.16 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p... 26 4.0 SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch... 26 4.0 SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosacch... 26 5.3 SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.2 SPBC36.02c |||spermidine family transporter |Schizosaccharomyces... 25 9.2 >SPBC428.07 |meu6||meiotic chromosome segregation protein Meu6|Schizosaccharomyces pombe|chr 2|||Manual Length = 651 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 48 PKPTSPARGAPCRSTNEALAETWSQKNQKLSPQVRSTATLP 170 P P + A+ P T +ALA + NQ PQV T P Sbjct: 600 PTPRTAAQEDPAEETTDALASAEGENNQ--MPQVLETEAAP 638 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 27.5 bits (58), Expect = 1.7 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 33 QVPSEPKPTSPARGAPCRSTNEALAETWSQKNQKLSPQVR 152 Q EP P S A +P + + EALAE + P R Sbjct: 60 QKKKEPSPASSASASPVKKSAEALAERSNSSMGTFDPPPR 99 >SPAC2F3.16 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 425 Score = 26.2 bits (55), Expect = 4.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 344 WLSYCSSTTCNSMLDCRF*VYEYLTSQCHSC 436 W+S CNS D + Y +L +C+SC Sbjct: 342 WISTIRCNDCNSRCDTK---YHFLGHKCNSC 369 >SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 26.2 bits (55), Expect = 4.0 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 524 VFLIFDCVCVCVCLFHNYSNSHIFDYIKKHSYDIERL 414 +FL CV L +N SN+ + IKK+S+ ERL Sbjct: 268 LFLSILCVGYYHHLLNNPSNTELQSLIKKYSFYSERL 304 >SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 25.8 bits (54), Expect = 5.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 351 LNHRPIVITCENKFSKSWL 295 LN + +V+ CE F K+WL Sbjct: 161 LNFKKLVLECECAFQKTWL 179 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 25.0 bits (52), Expect = 9.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 521 FLIFDCVCVCVCLFHNYSNSHI 456 FL F +CVCV L +S SH+ Sbjct: 155 FLFFFFLCVCVFLSFLFSLSHL 176 >SPBC36.02c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 25.0 bits (52), Expect = 9.2 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 502 TQSNIRKTYLTTLVLIKFSNLIFH*IHYYRS*VYLNLYIKL 624 T S+I K YL + + F+ I I Y S VY LY+ L Sbjct: 347 TLSDIAKNYLLVPMKLLFTEPICFLITLYSSFVYAILYLLL 387 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,201,076 Number of Sequences: 5004 Number of extensions: 38877 Number of successful extensions: 87 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -