BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P12 (460 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13F5.02c |ptr6|taf7|transcription factor TFIID complex subun... 25 7.3 SPBC4C3.03 |||homoserine kinase |Schizosaccharomyces pombe|chr 2... 24 9.7 >SPAC13F5.02c |ptr6|taf7|transcription factor TFIID complex subunit Taf7|Schizosaccharomyces pombe|chr 1|||Manual Length = 393 Score = 24.6 bits (51), Expect = 7.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -2 Query: 105 TTNRPRXGGAKTGTXSPQSAGDEEEKEND 19 +T PR G ++ + + +EEE+EN+ Sbjct: 297 STAEPRAAGEESASEEEEEEEEEEEEENE 325 >SPBC4C3.03 |||homoserine kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 338 Score = 24.2 bits (50), Expect = 9.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -2 Query: 267 RDILN*AYKIRDVPGNTGRLATLNXHVTPAWPGVGKCGARTFQLA 133 +D ++ Y+ +PG LATLN P G+ GA LA Sbjct: 253 KDKVHQPYRASLIPGLQNILATLNPDTQPGLCGICLSGAGPTVLA 297 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,353,350 Number of Sequences: 5004 Number of extensions: 22637 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -