BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P10 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) 201 5e-52 SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) 57 1e-08 SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098) 33 0.27 SB_56580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_55826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_55282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_19759| Best HMM Match : HATPase_c (HMM E-Value=1.1e-13) 30 1.9 SB_2932| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_2254| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_46104| Best HMM Match : rve (HMM E-Value=1.4e-10) 30 1.9 SB_11794| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) 30 1.9 SB_56665| Best HMM Match : rve (HMM E-Value=8.6e-16) 29 2.5 SB_39850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_26190| Best HMM Match : rve (HMM E-Value=3.1e-26) 29 2.5 SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) 29 2.5 SB_4788| Best HMM Match : rve (HMM E-Value=0) 29 2.5 SB_952| Best HMM Match : rve (HMM E-Value=9.4e-26) 29 2.5 SB_46362| Best HMM Match : rve (HMM E-Value=3e-26) 29 2.5 SB_42299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39) 29 2.5 SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 29 2.5 SB_3577| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_15856| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 29 3.3 SB_52367| Best HMM Match : RnaseH (HMM E-Value=0.53) 29 3.3 SB_45058| Best HMM Match : rve (HMM E-Value=2.6e-05) 29 3.3 SB_12284| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 29 4.4 SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) 29 4.4 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_38162| Best HMM Match : zf-CCCH (HMM E-Value=0.018) 28 5.8 SB_9151| Best HMM Match : WAP (HMM E-Value=0.045) 28 5.8 SB_7649| Best HMM Match : PolyA_pol (HMM E-Value=6.4) 28 5.8 >SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 201 bits (490), Expect = 5e-52 Identities = 96/110 (87%), Positives = 102/110 (92%) Frame = +3 Query: 174 YKTVSGVNGPLVILDEVKFPKFSEIVQLKLADGTLRSGQVLEVSGSKAVVQVFEGTSGID 353 YKTVSGVNGPLVILD VKFPKF+EIV L L DG+ RSG+VLEVSGSKAVVQVFEGTSGID Sbjct: 14 YKTVSGVNGPLVILDNVKFPKFAEIVTLTLQDGSQRSGEVLEVSGSKAVVQVFEGTSGID 73 Query: 354 AKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDFLDIQGQ 503 AK+T CEFTGDILRTPVSEDMLGRVFNGSGK ID+GPP+LAEDFLDIQ Q Sbjct: 74 AKHTTCEFTGDILRTPVSEDMLGRVFNGSGKAIDRGPPVLAEDFLDIQAQ 123 >SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) Length = 448 Score = 57.2 bits (132), Expect = 1e-08 Identities = 30/98 (30%), Positives = 51/98 (52%) Frame = +3 Query: 333 EGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDFLDIQGQPIN 512 +GT G+ + C TG + PV + LGR+ N G+PID+ P+ + I + Sbjct: 127 DGTEGL-IRGQKCVDTGGPITIPVGPETLGRIINVIGEPIDERGPVETDKRAAIHAEAPE 185 Query: 513 PWSRIYPEEMIQTGISAIDVMNSIARGQKIPIFSAAGL 626 +E+++TGI +D++ A+G KI +F AG+ Sbjct: 186 FVEMSTEQEILETGIKVVDLLAPYAKGGKIGLFGGAGV 223 >SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 49.2 bits (112), Expect = 3e-06 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 1/94 (1%) Frame = +3 Query: 321 VQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPID-KGPPILAEDFLDIQ 497 V VF G + + + + TG I+ PV E++LGRV + G PID KGP + ++ Sbjct: 12 VVVF-GNDRLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNPIDGKGPTGGTRARVGVK 70 Query: 498 GQPINPWSRIYPEEMIQTGISAIDVMNSIARGQK 599 I P R +E + TGI A+D + I RGQ+ Sbjct: 71 APGIIP--RTSVKEPMLTGIKAVDSLVPIGRGQR 102 >SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098) Length = 620 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/64 (31%), Positives = 34/64 (53%) Frame = -3 Query: 481 SSAKIGGPLSMGLPEPLNTRPNMSSETGVRRMSPVNSQSVFFASIPDVPSNTWTTALEPL 302 SS+ + P + P PL + ++S + + SP+ S S +S P + S + T+ PL Sbjct: 181 SSSPLTSPSPLTSPSPLTSSSPLTSSSPLTSSSPLTSSSPLTSSSP-LTSPSPLTSSSPL 239 Query: 301 TSST 290 TSS+ Sbjct: 240 TSSS 243 Score = 31.1 bits (67), Expect = 0.83 Identities = 26/94 (27%), Positives = 43/94 (45%) Frame = -3 Query: 457 LSMGLPEPLNTRPNMSSETGVRRMSPVNSQSVFFASIPDVPSNTWTTALEPLTSST*PER 278 +S P PL + ++S + + SP+ S S +S P + S++ T+ PLTSS+ Sbjct: 165 ISAYFPSPLTSSSPLTSSSPLTSPSPLTSPSPLTSSSP-LTSSSPLTSSSPLTSSSPLTS 223 Query: 277 RVPSASFSCTISENLGNLTSSKMTRGPFTPDTVL 176 P S S S + +S + P T + L Sbjct: 224 SSPLTSPSPLTSSSPLTSSSPLTSSSPLTSSSPL 257 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = -3 Query: 481 SSAKIGGPLSMGLPEPLNTRPNMSSETGVRRMSPVNSQSVFFASIPDVPSNTWTTALEPL 302 SS+ + + P PL + ++S + + SP+ S S +S P + S++ T+ PL Sbjct: 175 SSSPLTSSSPLTSPSPLTSPSPLTSSSPLTSSSPLTSSSPLTSSSP-LTSSSPLTSPSPL 233 Query: 301 TSST 290 TSS+ Sbjct: 234 TSSS 237 >SB_56580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPGR 105 ++ Y +HS EP +G V +LPG W+PG+ Sbjct: 949 QKXYYDKHSKPLEPIAVGETVRIKLPGQDTWTPGQ 983 >SB_55826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 473 GRGLLGHPGSAHQPMVTYLPRGDDPNWYLRY*CDELYCPWSEDP 604 GRG+ G+ H P + D W RY +CP+ ++P Sbjct: 38 GRGIGGYHQLCHDPSIPAKAVEPDEPWMCRYCSVGAFCPYLQNP 81 >SB_55282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1565 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +3 Query: 372 EFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDFLDIQGQPINP 515 E T D +R PV+ +L RV+NGS + D LAE+ ++G + P Sbjct: 1111 EETRDEIRDPVTRQILDRVYNGSVEFADLWVSGLAEN--PVKGASVGP 1156 >SB_19759| Best HMM Match : HATPase_c (HMM E-Value=1.1e-13) Length = 295 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPGR 105 ++ Y +HS EP +G V +LPG W+PG+ Sbjct: 19 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPGQ 53 >SB_2932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPGR 105 ++ Y +HS EP +G V +LPG W+PG+ Sbjct: 112 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPGQ 146 >SB_2254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPGR 105 ++ Y +HS EP +G V +LPG W+PG+ Sbjct: 19 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPGQ 53 >SB_46104| Best HMM Match : rve (HMM E-Value=1.4e-10) Length = 263 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 158 QKFYYNKHSKPLEPIAVGETVRMKLPGQDTWTPG 191 >SB_11794| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) Length = 331 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +1 Query: 367 SASSRVTFFVHRSLKTCWVACSTVPANPSTRVPQSWPRTSWTSRVSPSTHGHVSTQRR 540 S + ++ F +H +L + + T ANP+++ P TS S +PS + +T R Sbjct: 192 STTCKMGFQLHPNLNSVCIPIPTPTANPTSKPMPQLPPTSPPSTTTPSMPANHTTDNR 249 >SB_56665| Best HMM Match : rve (HMM E-Value=8.6e-16) Length = 608 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 490 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 523 >SB_39850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 98 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 131 >SB_26190| Best HMM Match : rve (HMM E-Value=3.1e-26) Length = 316 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 211 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 244 >SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) Length = 1036 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 931 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 964 >SB_4788| Best HMM Match : rve (HMM E-Value=0) Length = 1125 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 457 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 490 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 1007 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 1040 >SB_952| Best HMM Match : rve (HMM E-Value=9.4e-26) Length = 455 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 337 QKFYYDKHSKPLEPFAVGETVRMKLPGQDTWTPG 370 >SB_46362| Best HMM Match : rve (HMM E-Value=3e-26) Length = 455 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 337 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 370 >SB_42299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 121 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 154 >SB_39172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 156 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 189 >SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39) Length = 1060 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 211 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 244 >SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 960 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 842 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 875 >SB_3577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1164 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 651 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 684 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 1050 QKFYYDKHSKPLEPIAVGETVRMKLPGQDTWTPG 1083 >SB_15856| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) Length = 514 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 194 YTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 Y +HS EP +G V +LPG W+PG Sbjct: 400 YDKHSKPLEPIAVGETVRMKLPGQDTWTPG 429 >SB_52367| Best HMM Match : RnaseH (HMM E-Value=0.53) Length = 325 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 207 QKFYYYKHSKPLEPIAVGETVRMKLPGQDTWTPG 240 >SB_45058| Best HMM Match : rve (HMM E-Value=2.6e-05) Length = 272 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 206 ERTVYTRHSLVSEP-GLGNEVPWRLPGHVPWSPG 108 ++ Y +HS EP +G V +LPG W+PG Sbjct: 154 QKFYYYKHSKPLEPIAVGETVRMKLPGQDTWTPG 187 >SB_12284| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 238 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 549 TGISAIDVMNSIARGQKIPIFSAAGL 626 TGI ID++ A+G KI +F AG+ Sbjct: 5 TGIKVIDLIEPYAKGGKIGLFGGAGV 30 >SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) Length = 1039 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = -3 Query: 484 KSSAKIGGPLSMGLPEPLNTRPNMSSETGVRRMSPVNSQSVFFASIPDVPSNTWTTAL 311 +S+++IGG + + PL+ S + + R P QSV S+PD+ +N T AL Sbjct: 355 ESASRIGGCVLRTVSRPLSAPMPRRSISDLARELPTPRQSVRSVSLPDL-TNVETLAL 411 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +1 Query: 406 LKTCWVACSTVPANPSTRVPQSWPRTSWTSRVSPSTHGHVST 531 L TC ++ + P+ PSTR S P T T +PST ST Sbjct: 632 LCTCTLSTPSTPSTPSTRSTPSTPSTPSTPS-TPSTPSTPST 672 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -3 Query: 469 IGGPLSMGLPEPLNTRPNMSSETGVRRMSPVNSQSVFFASIPDVPSNTWTT 317 I G +S + + T S T +R +++Q F +PD PS+ +T+ Sbjct: 563 ISGDISFAMCDKSITNNTKSFHTKIRTPVQLSNQGSFTRKLPDAPSDHFTS 613 >SB_38162| Best HMM Match : zf-CCCH (HMM E-Value=0.018) Length = 541 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 439 PANPSTRVPQSWPRTSWTSRVSPSTH 516 P + TR P+S PR + TS+ +PS+H Sbjct: 93 PVSVPTRSPKSPPREAKTSKKTPSSH 118 >SB_9151| Best HMM Match : WAP (HMM E-Value=0.045) Length = 1865 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 397 HRSLKTCWVACSTVPANPSTRVPQSWPRTSWTSR 498 H +TC+ +P NP S +SWTSR Sbjct: 148 HEGQRTCFATKQFLPGNPCQWCDPSVSTSSWTSR 181 >SB_7649| Best HMM Match : PolyA_pol (HMM E-Value=6.4) Length = 318 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 461 TLVDGFAGTVEHATQHVFRDRCTKNVTRELAEC 363 T+VD G V+ VF T+N+TR+L C Sbjct: 182 TVVDTLEGFVDPFDLDVFSPHITRNLTRQLQRC 214 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,940,478 Number of Sequences: 59808 Number of extensions: 556379 Number of successful extensions: 1514 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1511 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -