BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P09 (449 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 4.1 SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ... 24 9.4 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 4.1 Identities = 12/57 (21%), Positives = 30/57 (52%) Frame = +2 Query: 20 IKSFAIPVVISKSPSMXKLWSECSRRHXMSLERTLAGLISQTTKNRSRLKYWYQKVL 190 + S + P +++K S+ + S+ +H RT+ L + + +++ K W +K++ Sbjct: 7 LDSSSEPSIVTKQFSVEECLSKLKEQHCYVPMRTIGRLRLRKSSDQTEKKCWKEKLM 63 >SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase Cho2|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 24.2 bits (50), Expect = 9.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 222 FIESTLVCDFCDILLL 269 F++ L+CDFC +L+ Sbjct: 210 FVDLILMCDFCSYILM 225 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,102,962 Number of Sequences: 5004 Number of extensions: 17387 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -