BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P08 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) fa... 32 0.34 At2g36720.1 68415.m04505 PHD finger transcription factor, putative 30 1.8 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 29 4.2 At2g46550.1 68415.m05807 expressed protein 28 5.6 At1g75140.1 68414.m08728 expressed protein 28 5.6 At1g19370.1 68414.m02410 expressed protein 28 5.6 At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR ... 28 7.4 At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR ... 28 7.4 >At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) family protein predicted proteins, Arabidopsis thaliana ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 32.3 bits (70), Expect = 0.34 Identities = 25/64 (39%), Positives = 27/64 (42%), Gaps = 11/64 (17%) Frame = +3 Query: 258 RNLDWESKAQLPTKRRRC-----------SPFAASPSTSPGLKTSESKPSSFGESVSAPV 404 RNL + KA LP RR P ASP TSP K S PSS +S V Sbjct: 68 RNLSLKRKASLPNYERRLLLSPSVSETSEKPLVASPITSPYWKRCLSLPSSNSAKLSLVV 127 Query: 405 KITP 416 TP Sbjct: 128 STTP 131 >At2g36720.1 68415.m04505 PHD finger transcription factor, putative Length = 1007 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/67 (23%), Positives = 28/67 (41%) Frame = +3 Query: 213 DFVGRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESV 392 D+ ++K+ C K + S + CS S ++ +TS S P+ V Sbjct: 365 DYASKEKRFTCKRCKGPFPFSSLGHRGFLCKSCSEVETSQASLAATRTSTSAPACITSPV 424 Query: 393 SAPVKIT 413 + +KIT Sbjct: 425 KSRLKIT 431 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 267 DWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESVSAPVKITPE 419 D E +AQ K+ + + + P + +KP+ G+ + A VK TPE Sbjct: 618 DEEEEAQPVVKKELKDAISKAHDSEPEAEKPTAKPAGTGKPLIAAVKATPE 668 >At2g46550.1 68415.m05807 expressed protein Length = 397 Score = 28.3 bits (60), Expect = 5.6 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = +3 Query: 228 KKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPS--TSPGLKT-SESKPSSFGESVSA 398 K ++A +R+LD+ LPT ++ + SP S GL+ S S + G S + Sbjct: 188 KDELASLVAQRSLDYVENCDLPTPQKMKRSYYGSPRGFDSDGLRDYSVSGQTIKGTSKGS 247 Query: 399 PVKITPERMAQEIYDEIKRLH--RRGQLR 479 K PE ++ + + L RR Q R Sbjct: 248 SCKNRPEASSESDLSKSELLEALRRSQTR 276 >At1g75140.1 68414.m08728 expressed protein Length = 617 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +1 Query: 79 SDFTXNLKTNCIFFFVYYLYGA*YYFS 159 ++F L ++ +FFF+ +L+GA ++FS Sbjct: 468 AEFNTMLWSSPVFFFILFLFGAWHFFS 494 >At1g19370.1 68414.m02410 expressed protein Length = 605 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 82 DFTXNLKTNCIFFFVYYLYGA*YYFS 159 DF L ++ +FFF+ +L+GA ++F+ Sbjct: 470 DFNTMLWSSPVFFFILFLFGAWHFFA 495 >At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 237 MACATLKRNLDWESKAQLPTKRRRCSPFAASPST-SPGLK 353 + C + +DWESK +RR SP PST SPG K Sbjct: 711 LMCNISEIRIDWESK-----ERRELSPTEILPSTGSPGFK 745 >At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 237 MACATLKRNLDWESKAQLPTKRRRCSPFAASPST-SPGLK 353 + C + +DWESK +RR SP PST SPG K Sbjct: 711 LMCNISEIRIDWESK-----ERRELSPTEILPSTGSPGFK 745 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,728,072 Number of Sequences: 28952 Number of extensions: 320348 Number of successful extensions: 896 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -