BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P07 (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 25 1.6 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 6.6 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 442 AIHFKKLKSVKLGIDDYQKFLDDLAKNKKVE 534 A HF+ KS K+ ++ Y K K K+E Sbjct: 101 ATHFEANKSFKITVETYNKHFSQREKVAKIE 131 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.4 bits (48), Expect = 6.6 Identities = 14/49 (28%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 339 RSQVRWKSHHALAKRQMDEASQSH-*WKENNNNGHGHSLQKTQIGKTRH 482 R + K HH +KR D Q+H + E NG I + H Sbjct: 839 RRMISEKKHHKRSKRVKDGKQQNHVSFPEFVQNGSAKQFANDYINEVLH 887 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.309 0.123 0.331 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,505 Number of Sequences: 2352 Number of extensions: 12352 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -