BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P05 (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 22 4.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 7.6 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 412 IALVPSLGLLLVQYYIP 362 I V S+G L+Q YIP Sbjct: 61 IQFVRSMGYYLIQIYIP 77 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 175 YKDLPICNIRVSHNNTIFTLTEPDGKVRIIRSCG 276 YK +P+ ++I L E + K + R CG Sbjct: 223 YKSVPMSFSSPRRRHSINLLEEDNQKPNVCRICG 256 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.137 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,138 Number of Sequences: 336 Number of extensions: 2362 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -