BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P05 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0022 - 5054548-5054663,5054899-5055103,5055194-5055261,505... 31 0.88 04_01_0110 + 1123238-1123450,1124211-1124997,1126126-1126403 29 2.7 >03_02_0022 - 5054548-5054663,5054899-5055103,5055194-5055261, 5055573-5055861,5056687-5056753,5057928-5057974 Length = 263 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -2 Query: 296 VFLNPSMPHDLMILTLPSGSVNVNIVLLWLTRILHIGRSL 177 +F+N S PH M+++ PS + + + LLW I+H+ SL Sbjct: 26 LFMNQSPPHVWMLMSRPSVIIKLILGLLWF--IVHLAISL 63 >04_01_0110 + 1123238-1123450,1124211-1124997,1126126-1126403 Length = 425 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 449 FKPPICKPLTADNRPGPKPWTLTRTVL 369 +KPP+ P +A RPG KP RT L Sbjct: 25 YKPPLPLPASASLRPGRKPAPRLRTAL 51 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.137 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,001,072 Number of Sequences: 37544 Number of extensions: 232832 Number of successful extensions: 503 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -