BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P05 (579 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 28 6.3 >SB_13147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +1 Query: 100 DSALKTKQNLFPTLESDYQLYNGIPYKDLPICNIRVSHNNTI 225 ++ + + +L+PT++ ++ IP + PI N +SHN T+ Sbjct: 143 NATVPSTMHLYPTMQLSHRQCIHIPQCNCPIDNASISHNATV 184 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 82 EKIIDLDSALKTKQNLFPTLESDYQLYN 165 +KI + ++ LK +QNL+ + SD LY+ Sbjct: 248 KKIAEAETKLKQQQNLYEAVRSDRNLYS 275 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.137 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,167,964 Number of Sequences: 59808 Number of extensions: 279695 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -