BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P05 (579 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30040.1 68414.m03673 gibberellin 2-oxidase / GA2-oxidase (GA... 31 0.73 At3g50410.1 68416.m05514 Dof-type zinc finger domain-containing ... 28 3.9 At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containi... 28 3.9 At3g22700.1 68416.m02864 F-box family protein contains Pfam:PF00... 27 9.0 >At1g30040.1 68414.m03673 gibberellin 2-oxidase / GA2-oxidase (GA2OX2) identical to GI:4678368 ga2ox2 Length = 341 Score = 30.7 bits (66), Expect = 0.73 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 175 YKDLPICNIRVSHNNTIFTLTEPDGKVRIIRSCGMEGF 288 YK +P+ SH+ + L +P+ K RI+++C GF Sbjct: 20 YKPVPVLT---SHSIPVVNLADPEAKTRIVKACEEFGF 54 >At3g50410.1 68416.m05514 Dof-type zinc finger domain-containing protein Length = 253 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 163 NGIPYKDLPICNIRVSHNNTI-FTLTEPDGKVRIIRSCG 276 NG+P + P+ + S +N + T+TE DGK + CG Sbjct: 105 NGVPLQTTPVLFPQSSISNGVTHTVTESDGKGSALSLCG 143 >At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 895 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 91 IDLDSALKTKQNLFPTLESDYQLYNGIPYKD 183 + + S+L T + +LE Y+L+ GIP+KD Sbjct: 485 LTVGSSLFTLYSKCGSLEESYKLFQGIPFKD 515 >At3g22700.1 68416.m02864 F-box family protein contains Pfam:PF00646 F-box domain Length = 338 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 409 RLSAVKGLQMGGLNIVSITDNTHVSWNP 492 ++ V+ L GL + + DN HV WNP Sbjct: 88 QVDIVQVLHCDGLLLCTTKDNRHVVWNP 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.137 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,593,884 Number of Sequences: 28952 Number of extensions: 193648 Number of successful extensions: 479 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -