BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P03 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31540| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 29 3.5 >SB_31540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 186 IISEQNEASSEMLLLCFYSDRIPDHCY-PRHHTFDSHNH 299 IIS N S+ + + C S P H Y HH SHNH Sbjct: 203 IISTINTTSTVITITCNISTTPPQHHYHHHHHNHYSHNH 241 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 554 VIDV*RILISKPIAKTIPSTTHGSINHDRRLFIA 453 ++DV ++ S P TTH S++HD+RL A Sbjct: 293 LVDVYCMVSSDPTLSATADTTHTSLSHDKRLSTA 326 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,909,363 Number of Sequences: 59808 Number of extensions: 340564 Number of successful extensions: 813 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -