BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_P03 (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF056617-1|AAF00004.1| 606|Homo sapiens BWSCR2 associated zinc-... 33 0.72 >AF056617-1|AAF00004.1| 606|Homo sapiens BWSCR2 associated zinc-finger protein BAZ1 protein. Length = 606 Score = 33.5 bits (73), Expect = 0.72 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +3 Query: 258 HCYPRHHTFDSHNHIDMDCQETHSLIQHIYL*QGIRQEAFRLRHSKDNFNNKFMFH-HLD 434 H + R HT + I+ D + + + HI+ I ++ F+ +FN + H H Sbjct: 319 HNHQRVHTEEKFYKIECDKDLSRNSLLHIHQRLHIGEKPFKCNQCGKSFNRSSVLHVHQR 378 Query: 435 LHTSDRRYK 461 +HT ++ YK Sbjct: 379 VHTGEKPYK 387 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,569,605 Number of Sequences: 237096 Number of extensions: 1462690 Number of successful extensions: 2710 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2708 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -