BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O21 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 25 1.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 2.5 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 24 3.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.4 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +2 Query: 416 PNVHYMDGICEGSSRTAHHSDV 481 PN H++ G +G ++T H +D+ Sbjct: 38 PNPHFLFGHAKGQAQTRHGADI 59 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 2.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 293 VMPSRHKQTEDDYRNRP 343 +MPS+H+ T + Y RP Sbjct: 544 MMPSKHRTTAEGYTQRP 560 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 24.2 bits (50), Expect = 3.3 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 203 TISDIQHRNYLFSQEQETPVKEKKL-TAGIFVMPSRHKQTEDDYRNRPDY 349 T++D + + + S E + +KEKKL T V+P ++ +D R+ Y Sbjct: 86 TVNDFRLKIAVVSYEPDDEIKEKKLVTLNNEVIPFYLEKLDDIARDNNGY 135 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 196 KVF*LRTFPYEHAVGYPNDDQCGQYKSAY 110 KV R+FPY++ Y DD K+ Y Sbjct: 2256 KVLSTRSFPYQYGHRYDYDDHDQLIKAKY 2284 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 196 KVF*LRTFPYEHAVGYPNDDQCGQYKSAY 110 KV R+FPY++ Y DD K+ Y Sbjct: 2266 KVLSTRSFPYQYGHRYDYDDHDQLIKAKY 2294 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,981 Number of Sequences: 2352 Number of extensions: 13663 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -