BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O19 (541 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 27 8.6 U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astaci... 27 8.6 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 314 HRGRRTSTVREPQEPHFRYRRSSIQQIPGLFCHQKFQSQSRNPQGRY 174 HR R S + + R R S + P ++ S+SR+P+ RY Sbjct: 3 HRSRSNSRSQSRSRENSRGRSRSASKSPVYHRRERESSRSRSPRARY 49 >U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astacin protease protein33 protein. Length = 644 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 425 YIFRWCWWFRL-EGAGECLLRRDGNHFRQRCTSSRGPFHRGRRT 297 Y W W R E G C G +R+RCTS+ ++T Sbjct: 549 YSLLWSGWTRCSENCGSC-----GTQYRERCTSTTNCLRSAKQT 587 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,130,868 Number of Sequences: 27780 Number of extensions: 212250 Number of successful extensions: 636 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1081316076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -