BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O15 (608 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1620.05 |||Rab geranylgeranyltransferase |Schizosaccharomyce... 31 0.17 SPBC1921.02 |rad60||DNA repair protein Rad60 |Schizosaccharomyce... 29 0.70 SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizos... 27 1.6 SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr... 27 2.1 SPAC29A4.08c |prp19|cwf8|ubiquitin-protein ligase E4 |Schizosacc... 26 3.7 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 26 5.0 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 25 8.7 >SPCC1620.05 |||Rab geranylgeranyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 344 Score = 30.7 bits (66), Expect = 0.17 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +1 Query: 157 ELTPTQVKDQPSVTFEAEADAFYTLVFTDPDNYDGPELVYREWHHWLVGN 306 E P K E E D + VFTDPD D +Y H WL+G+ Sbjct: 201 EADPNSQKALAKQILEQELDMIHQAVFTDPD--DSSVWIY---HRWLMGH 245 >SPBC1921.02 |rad60||DNA repair protein Rad60 |Schizosaccharomyces pombe|chr 2|||Manual Length = 406 Score = 28.7 bits (61), Expect = 0.70 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 204 LKSDRRLILHL-CRSQLISLRRYSTARVFKLN 112 LK D RL++H C S ISL+R V KL+ Sbjct: 289 LKVDTRLVVHAYCHSDFISLKRIKELEVEKLS 320 >SPBC18H10.08c |ubp4||ubiquitin C-terminal hydrolase Ubp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 27.5 bits (58), Expect = 1.6 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 6/92 (6%) Frame = -3 Query: 309 NVSYEPVVPFTVDQLRAXXXXXXREHERIKSISLGLKSDRRLILH-----LC-RSQLISL 148 N S P+ P T DQL A I+ +L L+S++ ++++ LC R+Q ++ Sbjct: 184 NASRSPIAPLTEDQLSAREELPLSHFSHIE-WNLHLRSNKSIVVNNFVGQLCSRTQCMTC 242 Query: 147 RRYSTARVFKLNVLSWSDGNDIRHYFASFECL 52 R ST ++ D D+ H + ECL Sbjct: 243 GRTSTTFAPFTSLAIPID--DVSHVVSLQECL 272 >SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1225 Score = 27.1 bits (57), Expect = 2.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 82 DVIPVAPTKNIELKYPSGAIASQGNELTPTQVK 180 D+I TK +E+ +P GA LTP VK Sbjct: 994 DLISKGATKPLEIAFPDGASILVAFRLTPVPVK 1026 >SPAC29A4.08c |prp19|cwf8|ubiquitin-protein ligase E4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 26.2 bits (55), Expect = 3.7 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +1 Query: 46 VAQAFEASKIVPDV-IPVAPTKNIELKYPSGAIASQGNELTPTQVKDQPSVTFEAEADAF 222 VAQ + + PD + VA +N EL++ S GNELT P T + + + Sbjct: 332 VAQHITSLAVHPDGNLFVAGLENGELRFFE---TSSGNELTKFGPHSSPVKTLQFGENGY 388 Query: 223 YTLVFTDPDN 252 + +V T+ D+ Sbjct: 389 WLVVTTNDDS 398 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 25.8 bits (54), Expect = 5.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 343 SGYIGSGPPQGYWDPSLRL 399 +G +G GP G+W PS R+ Sbjct: 641 TGPVGKGPGCGFWAPSWRV 659 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 25.0 bits (52), Expect = 8.7 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = +1 Query: 49 AQAFEASKIVPDVIPVAPTKNIELKYPSGAIASQGNELTPTQVKDQPS 192 A+ + S +VP A K P+ A+ G PT K QP+ Sbjct: 421 AETQDKSTVVPQESATATPKRSPSATPTSALPPIGKFAPPTTAKAQPA 468 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,395,146 Number of Sequences: 5004 Number of extensions: 47379 Number of successful extensions: 151 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -